DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14628 and fz3

Sequence 1:NP_569883.1 Gene:CG14628 FlyBaseID:FBgn0040365 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001096859.1 Gene:fz3 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster

Alignment Length:137 Identity:94/138 (68%)
Similarity:105/138 (76%) Gaps:8/138 (6%)


  Fly     1 MSASDIAGIELTSGPTGLKSRILVRNLPVCTRQELAYLCLPFGEILGSLVTNNQGFIQFARESEA 65
            ||.||||||:||||||.|:|||||||||.|||:||::||.|||.||||||.:|.||||||.|.||
  Fly     1 MSGSDIAGIKLTSGPTSLRSRILVRNLPPCTREELSFLCYPFGTILGSLVIDNHGFIQFATEREA 65

  Fly    66 KLAIETLDHTTFKSKVILVSNASFRSLNASCLGYAPP-GQMMIEWSDEDDV-------DEYDDYS 122
            ..|||.|:|:|||||.|||||||||||.|:|..|||| .:.||.|||.|||       ||.||..
  Fly    66 TRAIEALNHSTFKSKDILVSNASFRSLKANCCVYAPPKKKRMIAWSDADDVSIVERNEDEDDDDY 130

  Fly   123 ESDDEDG 129
            :||||.|
  Fly   131 KSDDEKG 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14628NP_569883.1 RRM <19..>85 CDD:223796 48/66 (73%)
RRM_SF 22..85 CDD:240668 46/63 (73%)
fz3NP_001096859.1 RRM <19..>122 CDD:223796 70/103 (68%)
RRM_1 22..83 CDD:278504 44/61 (72%)
CRD_FZ <138..224 CDD:295308 94/138 (68%)
Frizzled 291..584 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002730
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.