DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and AT1G62820

DIOPT Version :10

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_176470.1 Gene:AT1G62820 / 842581 AraportID:AT1G62820 Length:148 Species:Arabidopsis thaliana


Alignment Length:147 Identity:52/147 - (35%)
Similarity:82/147 - (55%) Gaps:10/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 ISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEF 270
            :|..|:...:|||.|||.||||.|...|||.:|||||......:|:.::...::...  ..|..|
plant     6 LSNDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTESQLKSIITTENLSSP--FDFNRF 68

  Fly   271 VDILSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMI 335
            :|:::...        ..:..:|:|||||:|.||...|::..:|||.:|..:||.|...:.::.|
plant    69 LDLMAKHL--------KTEPFDRQLRDAFKVLDKEGTGFVAVADLRHILTSIGEKLQPSEFDEWI 125

  Fly   336 KEVDVDGDGRIDFYEFV 352
            |||||..||:|.:.:|:
plant   126 KEVDVGSDGKIRYEDFI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 PTZ00184 210..352 CDD:185504 50/141 (35%)
AT1G62820NP_176470.1 PTZ00184 4..148 CDD:185504 52/147 (35%)

Return to query results.
Submit another query.