DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and PC1

DIOPT Version :10

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001318585.1 Gene:PC1 / 28721170 AraportID:AT5G17480 Length:83 Species:Arabidopsis thaliana


Alignment Length:60 Identity:25/60 - (41%)
Similarity:39/60 - (65%) Gaps:1/60 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 EFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVD 272
            |....|:.||.:|||.|:..||...:::||. ...::::.|:.|||.|||||:|::||.|
plant     9 EHDRIFKKFDANGDGKISAAELEEALKTLGS-VTADDVKRMMAEIDTDGDGNISYQEFTD 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 PTZ00184 210..352 CDD:185504 25/60 (42%)
PC1NP_001318585.1 EFh 12..68 CDD:238008 24/57 (42%)

Return to query results.
Submit another query.