DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and MYL12B

DIOPT Version :10

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_291024.1 Gene:MYL12B / 103910 HGNCID:29827 Length:172 Species:Homo sapiens


Alignment Length:159 Identity:45/159 - (28%)
Similarity:82/159 - (51%) Gaps:14/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 KGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVD 272
            :.|::||:|||.:.|::.||.|.||:|..::.|||:......|..|:.|    ..|.::|..|:.
Human    28 QSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNE----APGPINFTMFLT 88

  Fly   273 ILSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIKE 337
            :....       |:..|.|: .:|:||..||:...|.|....||.:|..:|:...:|:::::.:|
Human    89 MFGEK-------LNGTDPED-VIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYRE 145

  Fly   338 VDVDGDGRIDFYEFVHALGEPEDSQENDD 366
            ..:|..|..::.||...|  ...:::.||
Human   146 APIDKKGNFNYIEFTRIL--KHGAKDKDD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 PTZ00184 210..352 CDD:185504 41/141 (29%)
MYL12BNP_291024.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PTZ00184 25..163 CDD:185504 42/146 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.