DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3704 and gpn1

Sequence 1:NP_569872.1 Gene:CG3704 FlyBaseID:FBgn0040346 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001003633.1 Gene:gpn1 ZFINID:ZDB-GENE-040801-154 Length:349 Species:Danio rerio

Alignment Length:341 Identity:169/342 (49%)
Similarity:226/342 (66%) Gaps:18/342 (5%)


  Fly    31 MAGSGKTTFTQKLIQHA-QEKFNPYVVNLDPACREVPYAAHVDIRDTVNYREVMKQYQLGPNGGI 94
            |||||||||.|:|..:. .:|..|||:|||||..|||:.|::||||||||:||||||.|||||||
Zfish     1 MAGSGKTTFVQRLTAYLHSKKTPPYVINLDPAVHEVPFPANIDIRDTVNYKEVMKQYGLGPNGGI 65

  Fly    95 VTALNMFTTKMAQFAELVRRAGERGHKWCVIDTPGQIEVFNWSASGSIITEGLATMFPTIVVYVM 159
            ||:||:|.|:..|..:.:.:. :..|::.:||||||||||.|||||:||||.||:.||.:|:|||
Zfish    66 VTSLNLFATRFDQVMKFIEKK-QSNHEYVLIDTPGQIEVFTWSASGTIITEALASSFPCVVIYVM 129

  Fly   160 DVERSACPTTFMSNMLYACSILYKTRLPFLVALNKIDLKDCGFVMDWMTDFEAFQEAQEEEHSFV 224
            |..||..|.||||||||||||||||:|||:|.:||.|:.|..|.::||.|||.||:|..:|.|::
Zfish   130 DTSRSVNPVTFMSNMLYACSILYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEVFQDALNQETSYI 194

  Fly   225 SNLTRTMSLTLDTFYENLRTCGVSAKTGVGFTQLLTKILESVDEYETDYKPVYEKKRQERL-AES 288
            |||||:|||.||.||.|||..||||.||.|..:|..::.::..||||:|:|.||:..:|.. |:|
Zfish   195 SNLTRSMSLVLDEFYTNLRVVGVSAVTGSGLDELFVQVADAAKEYETEYRPEYERLHRELAEAQS 259

  Fly   289 ATGPKPVDHVEEDGHAVPLGLSLQDPPPHTGNSIFLMAPSLVPESAEIEDEEEMEEDAKGTAEEQ 353
            ....:.::.:.:|..|||:..:.....|..|....|:.....|:.|    |||::.|....    
Zfish   260 QKQQEQLERLRKDMGAVPMETAAPTEAPDLGGPSDLIFTRGNPDEA----EEEIDSDTDDI---- 316

  Fly   354 NFHSFVQNHLTAQQSK 369
                   :|...::||
Zfish   317 -------DHTVTEESK 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3704NP_569872.1 Gem1 24..199 CDD:224025 107/169 (63%)
ATP_bind_1 28..268 CDD:281079 142/238 (60%)
gpn1NP_001003633.1 ATP_bind_1 1..239 CDD:281079 143/239 (60%)
Gem1 1..203 CDD:224025 126/203 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8158429
eggNOG 1 0.900 E1_KOG1532
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5257
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1096688at2759
OrthoFinder 1 1.000 FOG0004473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127563
Panther 1 1.100 LDO PTHR21231
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R835
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.