DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3704 and gop-2

Sequence 1:NP_569872.1 Gene:CG3704 FlyBaseID:FBgn0040346 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_498118.1 Gene:gop-2 WormBaseID:WBGene00001661 Length:355 Species:Caenorhabditis elegans

Alignment Length:365 Identity:165/366 (45%)
Similarity:223/366 (61%) Gaps:32/366 (9%)


  Fly     1 MAEGVESIKLEALSLSE--------GIRESPVCILVLGMAGSGKTTFTQKL--IQHAQEKFNPYV 55
            |||..|::...:...||        .:.:.| .||||||||||||||.|:|  ..||: |..|||
 Worm     1 MAEKAENLPSSSAEASEEPSPQTGPNVNQKP-SILVLGMAGSGKTTFVQRLTAFLHAR-KTPPYV 63

  Fly    56 VNLDPACREVPYAAHVDIRDTVNYREVMKQYQLGPNGGIVTALNMFTTKMAQFAELVRRAGERGH 120
            :|||||..:|||..:|||||||.|:||||::.:||||.|:|.||:..|:..:..||:.:... ..
 Worm    64 INLDPAVSKVPYPVNVDIRDTVKYKEVMKEFGMGPNGAIMTCLNLMCTRFDKVIELINKRSS-DF 127

  Fly   121 KWCVIDTPGQIEVFNWSASGSIITEGLATMFPTIVVYVMDVERSACPTTFMSNMLYACSILYKTR 185
            ..|::|||||||.|.|||||||||:.||:..||:|:|::|..|:..||||||||||||||||:|:
 Worm   128 SVCLLDTPGQIEAFTWSASGSIITDSLASSHPTVVMYIVDSARATNPTTFMSNMLYACSILYRTK 192

  Fly   186 LPFLVALNKIDLKDCGFVMDWMTDFEAFQEAQEE-EHSFVSNLTRTMSLTLDTFYENLRTCGVSA 249
            |||:|..||.|:....|.:.||.|||.|.||.|: ..|::::|:|::||.||.||..|:|..||:
 Worm   193 LPFIVVFNKADIVKPTFALKWMQDFERFDEALEDARSSYMNDLSRSLSLVLDEFYCGLKTVCVSS 257

  Fly   250 KTGVGFTQLLTKILESVDEYETDYKPVYEKKRQERLAESATGPKPVDHVEEDGHAVPLGLSLQDP 314
            .||.||..::|.|.|||:.|:.:|.|:|||...|:........|..|.....|.||         
 Worm   258 ATGEGFEDVMTAIDESVEAYKKEYVPMYEKVLAEKKLLDEEERKKRDEETLKGKAV--------- 313

  Fly   315 PPHTGNSIFLMAPSLVPE-SAEIED------EEEMEEDAK 347
              |..|.:......|..| :::|:.      :||.||||:
 Worm   314 --HDLNKVANPDEFLESELNSKIDRIHLGGVDEENEEDAE 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3704NP_569872.1 Gem1 24..199 CDD:224025 103/177 (58%)
ATP_bind_1 28..268 CDD:281079 133/243 (55%)
gop-2NP_498118.1 Gem1 33..241 CDD:224025 117/210 (56%)
ATP_bind_1 35..276 CDD:281079 133/243 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8158757
eggNOG 1 0.900 E1_KOG1532
Hieranoid 1 1.000
Homologene 1 1.000 H5257
Inparanoid 1 1.050 280 1.000 Inparanoid score I1737
Isobase 1 0.950 0 Normalized mean entropy S522
OMA 1 1.010
OrthoDB 1 1.010 D1096688at2759
OrthoFinder 1 1.000 FOG0004473
OrthoInspector 1 1.000 T476104
orthoMCL 1 0.900 OOG5_127563
Panther 1 1.100 LDO PTHR21231
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R835
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.