DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and KEL2

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_011754.3 Gene:KEL2 SGDID:S000003470 Length:882 Species:Saccharomyces cerevisiae

Alignment Length:907 Identity:178/908 (20%)
Similarity:309/908 (34%) Gaps:252/908 (28%)


  Fly   207 SGSGSGKATSPGSYSCNALNVDFTSYTATHQWTRM-LECAEFVGAKRSKHTVVAYKDAMFVFGGD 270
            ||:.:....||.|.:           |..:.|.|: |:.:.|...:.|...:|...:.:||.||.
Yeast    53 SGASTALPWSPESKN-----------TGKYIWNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGL 106

  Fly   271 NGKNMLNDLIRFGVKDKSWGRAC-ATGT------------PPAPRYHHSAVVAGSSMFIFGGYTG 322
            :.:::..|:         |..|. |.||            .|.||..|::.:.|::..:|||.|.
Yeast   107 HDQSVYGDV---------WQIAANADGTSFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTH 162

  Fly   323 DIHSNSNLTNKNDLFEYKFQSAMWVEWKFSGRQPVPRSAHGAAV-----YDNKMWIYAGYDGNAR 382
            .::.|..|  .:||:.:...|..|...:..||:|:.|..|..::     ...|::::.|......
Yeast   163 KLNKNGLL--DDDLYLFNINSYKWTIPQPIGRRPLGRYGHKISIIASNPMQTKLYLFGGQVDETY 225

  Fly   383 LNDMWTLNLTG----ENQWEEVDQLGDRPPTCCNFPVAVARDAMYVFSGQSGLQITNSLFEFHFK 443
            .||:...:|:.    .:.||.::.:||.||...|..:....:.::||.|::...|:|..:.:...
Yeast   226 FNDLVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGGETPKTISNDTYRYDPA 290

  Fly   444 TRTWRRISNEPVLRGATSAPPSRRYGHTMVHHDRFLYVFGG-SADSTLPNDLHCYDLDSQVWSVI 507
            ...|.::.       .|...|.....|..|.:...:.|.|| ...:...||::..:|.|..|..:
Yeast   291 QSEWSKVK-------TTGEKPPPIQEHASVVYKHLMCVLGGKDTHNAYSNDVYFLNLLSLKWYKL 348

  Fly   508 QPEQNSDVPSGRVFHASAVI-CDAMYIFGG--------------TVDNSVRRGD-TYRFQFSSYP 556
             |.....:|..|..|:..:: .:.:.|.||              |.:.....|. .|....||. 
Yeast   349 -PRMKEGIPQERSGHSLTLMKNEKLLIMGGDKTDYASPNIHDLQTSETDQGEGTLLYTLDLSSL- 411

  Fly   557 KCTLRDDFGKFFQDKQFCD---IQFIVGAEEIRILAHIAFVAARSKYLRNKILAAREARQQQMEK 618
                          .:.|.   .:.:...|.........|..::|....|:.:......:....|
Yeast   412 --------------NELCPGIMCESLHAGESFSNSLSGGFTPSKSTESENQEIINILTPRLPDSK 462

  Fly   619 VYGVGQVDALALNAGAGGDRGPMLEVRLANASPEAFEIILNYIYTDRIDLKDTYSK--------- 674
            |.....:|     .|||.....:        ..:|||     ..:||.:.|...||         
Yeast   463 VLSYNDID-----EGAGSYSSAL--------DDKAFE-----RKSDREEKKPQSSKVDSSINKES 509

  Fly   675 ---NIIILITDIYQLAGLFTMPRLAHGCIQYLDYKINK-----------LNVLEALYNADKSNIK 725
               .|.:...:...|.|| |:....:|...|.|....|           ||:......|.:..::
Yeast   510 PGTGIKVSKKNFPVLRGL-TVDSEEYGSSSYKDTSCQKGIPKNLFDDLNLNLQTLRLEAQQKELE 573

  Fly   726 IIKDHCMQ--------FIIKE----ENF----------TDVVMSSEFSDLDKPLLVEIIRKRLYP 768
            ..: |..|        .:|||    .||          ....:.|..:||...|:|::.:    .
Yeast   574 TAR-HISQLEKEVQRLMVIKEASKDSNFQTARLKNLEIQKTFLESRINDLKNLLMVKLSQ----A 633

  Fly   769 SKLVIDTSYEGN-IGTTLE--------IDLCAFLESTGKDFCDI----SLVLEDH---VIPAHKS 817
            |||....:.:.| :.|..|        |||        ::.||:    :.:|.::   :.|...:
Yeast   634 SKLCDQITIQNNGLKTCSEHVTIKRDIIDL--------ENKCDVLKRQNEILVNNMQKITPELHT 690

  Fly   818 VLSSRCTYFQGMFRSF----MPPDNTVNIQIGE------ISPSLEAFHSLLRYIYYGETKMPPQD 872
            .|:....|...:.:|:    .||.:..:.||.|      |...:...|..:|             
Yeast   691 YLNESSCYLGKLLKSYPTSARPPSSEKDNQIYEKDSLNKIEKVINEMHETVR------------- 742

  Fly   873 ALYLFQAPCFYGLANNRLHAFC------KYSLEHNITFENVLQTLEA----SD-ITKIYDIKEYA 926
                         |..:||...      :.||..|:...|  ..|:|    || .:|..|:.:.|
Yeast   743 -------------AKEKLHLETQKLNDERDSLRANLLDNN--NKLDALRKLSDGSSKSMDLTKKA 792

  Fly   927 LKLIVKDFAKVARLPKIAGLSRELLLEIIRAVAD--------------SHGEF--LTRININ 972
            :.|      ..:.|.|....:.:|..||.|...:              :||.|  ..|:.||
Yeast   793 IHL------SQSELEKYRKNNDDLQKEIDRIKTEQAEQDDKQEQRGAITHGNFDAFHRMKIN 848

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 77/357 (22%)
KELCH repeat 252..298 CDD:276965 12/59 (20%)
Kelch_3 261..310 CDD:290151 14/62 (23%)
Kelch_5 299..>329 CDD:290565 10/30 (33%)
KELCH repeat 302..355 CDD:276965 15/53 (28%)
Kelch_1 358..400 CDD:279660 9/51 (18%)
KELCH repeat 359..407 CDD:276965 11/57 (19%)
KELCH repeat 410..455 CDD:276965 7/45 (16%)
Kelch_1 410..452 CDD:279660 7/42 (17%)
Kelch_1 466..509 CDD:279660 10/44 (23%)
KELCH repeat 467..509 CDD:276965 10/43 (23%)
BTB 564..704 CDD:279045 26/155 (17%)
BTB 575..707 CDD:197585 26/147 (18%)
SPOP_C_like 707..766 CDD:269810 16/92 (17%)
BTB 798..898 CDD:279045 19/123 (15%)
BTB 802..902 CDD:197585 20/123 (16%)
SPOP_C_like 902..960 CDD:269810 15/63 (24%)
KEL2NP_011754.3 muta_rot_YjhT 103..381 CDD:274641 65/297 (22%)
Kelch_4 141..185 CDD:290154 14/46 (30%)
KELCH repeat 142..190 CDD:276965 13/50 (26%)
Kelch_3 213..265 CDD:290151 12/52 (23%)
Kelch_1 256..299 CDD:279660 7/50 (14%)
KELCH repeat 257..308 CDD:276965 9/58 (16%)
KELCH repeat 310..353 CDD:276965 11/44 (25%)
Kelch_3 316..366 CDD:290151 12/51 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122497597
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T133802
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.