DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and Lztr1

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_080084.2 Gene:Lztr1 MGIID:1914113 Length:837 Species:Mus musculus

Alignment Length:833 Identity:423/834 (51%)
Similarity:552/834 (66%) Gaps:83/834 (10%)


  Fly   203 ASSGSGSGSGKAT-------SPG---SYSCN----ALNVDFTSYTATHQWTRMLECAEFVGAKRS 253
            |.||...|||..|       :|.   .:||:    .|.::|..:...|:|.|:..|.|||||:||
Mouse     2 AGSGGPIGSGALTGGVRSKVAPSVDFDHSCSDSVEYLTLNFGPFETVHRWRRLPPCDEFVGARRS 66

  Fly   254 KHTVVAYKDAMFVFGGDNGKNMLNDLIRFGVKDKSWGRACATGTPPAPRYHHSAVVAGSSMFIFG 318
            ||||||||||::||||||||.|||||:||.|||.||.||..|||||||||||||||.|||||:||
Mouse    67 KHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCSWCRAFTTGTPPAPRYHHSAVVYGSSMFVFG 131

  Fly   319 GYTGDIHSNSNLTNKNDLFEYKFQSAMWVEWKFSGRQPVPRSAHGAAVYDNKMWIYAGYDGNARL 383
            ||||||:|||||.||||||||||.:..|.|||..||.||.||||||.||.:|:||:|||||||||
Mouse   132 GYTGDIYSNSNLKNKNDLFEYKFATGQWTEWKIEGRLPVARSAHGATVYSDKLWIFAGYDGNARL 196

  Fly   384 NDMWTLNLTGENQ--WEEVDQLGDRPPTCCNFPVAVARDAMYVFSGQSGLQITNSLFEFHFKTRT 446
            |||||:.|.....  ||||.|.|:.||:||||||||.||.|:|||||||.:|||:||:|.||.:|
Mouse   197 NDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFKDKT 261

  Fly   447 WRRISNEPVLRGATSAPPSRRYGHTMVHHDRFLYVFGGSADSTLPNDLHCYDLDSQVWSVIQPEQ 511
            |.||..|.:||| :..||.||||||||..||.||||||:||:||||:|||||:|.|.|.|:||..
Mouse   262 WTRIPTEHLLRG-SPPPPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDFQTWEVVQPSS 325

  Fly   512 NSDV----------------------------------------------------PSGRVFHAS 524
            :|:|                                                    ||||:|||:
Mouse   326 DSEVGGAEMPERASSSEDASTLTSEERSSFKKSRDVFGLDFGTTSAKQPVHLASELPSGRLFHAA 390

  Fly   525 AVICDAMYIFGGTVDNSVRRGDTYRFQFSSYPKCTLRDDFGKFFQDKQFCDIQFIVGAEEIRILA 589
            |||.||||||||||||::|.|:.||||||.||||||.:|:|:.::.:||||::|::|.:|..:..
Mouse   391 AVISDAMYIFGGTVDNNIRSGEMYRFQFSCYPKCTLHEDYGRLWEGRQFCDVEFVLGEKEECVQG 455

  Fly   590 HIAFVAARSKYLRNKILAAREARQQQMEKVYGVGQVDALALNAGAGGDRGPMLEVRLANASPEAF 654
            |:|.|.|||::||.||:.|:|...|::|:...:...:  |.....|..|.|:|.|.:..|....|
Mouse   456 HVAIVTARSRWLRRKIVQAQEWLAQKLEEDGALAPKE--APGPAVGRARPPLLRVAIREAEARPF 518

  Fly   655 EIILNYIYTDRIDLKDTYSKNIIILITDIYQLAGLFTMPRLAHGCIQYLDYKINKLNVLEALYNA 719
            |:::.::|||:|..........::||.|:|:||..|.:.||...|.||::..::..|||....:|
Mouse   519 EVLMQFLYTDKIKYPRKGHVEDVLLIMDVYKLALSFQLCRLEQLCRQYIEASVDLQNVLVVCESA 583

  Fly   720 DKSNIKIIKDHCMQFIIKEENFTDVVMSSEFSDLDKPLLVEIIRKRLY-----PSKLVIDTSYEG 779
            .:..:..:|:||:.||:||.:|..|:|..||..|..||:|||:|::..     ||...:|     
Mouse   584 ARLQLGQLKEHCLNFIVKESHFNQVIMMKEFERLSSPLIVEIVRRKQQPPPRTPSDQPVD----- 643

  Fly   780 NIGTTLEIDLCAFLESTGKDFCDISLVLEDHVIPAHKSVLSSRCTYFQGMFRSFMPPDNTVNIQI 844
             |||:|..|:.|:||..|.:||||:|:|:....||||::|::|.:||:.|||||||.|..|||.|
Mouse   644 -IGTSLIQDMKAYLEGAGSEFCDITLLLDGQPRPAHKAILAARSSYFEAMFRSFMPEDGQVNISI 707

  Fly   845 GEISPSLEAFHSLLRYIYYGETKMPPQDALYLFQAPCFYGLANNRLHAFCKYSLEHNITFENVLQ 909
            ||:.||.:||.|:||||||||..|||:|:||||.||.:||..||||.|:||.:||.|:|.:||||
Mouse   708 GEMVPSRQAFESMLRYIYYGEVNMPPEDSLYLFAAPYYYGFYNNRLQAYCKQNLEMNVTVQNVLQ 772

  Fly   910 TLEASDITKIYDIKEYALKLIVKDFAKVARLPKIAGLSRELLLEIIRAVADSH 962
            .|||:|.|:..|:|.:.|.:||..|.||::||.:..||::|||:||.::| ||
Mouse   773 ILEAADKTQALDMKRHCLHIIVHQFTKVSKLPTLRLLSQQLLLDIIDSLA-SH 824

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 228/371 (61%)
KELCH repeat 252..298 CDD:276965 37/46 (80%)
Kelch_3 261..310 CDD:290151 40/49 (82%)
Kelch_5 299..>329 CDD:290565 27/30 (90%)
KELCH repeat 302..355 CDD:276965 42/53 (79%)
Kelch_1 358..400 CDD:279660 29/44 (66%)
KELCH repeat 359..407 CDD:276965 32/50 (64%)
KELCH repeat 410..455 CDD:276965 31/45 (69%)
Kelch_1 410..452 CDD:279660 30/42 (71%)
Kelch_1 466..509 CDD:279660 32/43 (74%)
KELCH repeat 467..509 CDD:276965 31/42 (74%)
BTB 564..704 CDD:279045 47/140 (34%)
BTB 575..707 CDD:197585 43/132 (33%)
SPOP_C_like 707..766 CDD:269810 23/59 (39%)
BTB 798..898 CDD:279045 60/100 (60%)
BTB 802..902 CDD:197585 61/100 (61%)
SPOP_C_like 902..960 CDD:269810 28/58 (48%)
Lztr1NP_080084.2 KELCH repeat 65..111 CDD:276965 38/46 (83%)
Kelch_3 74..123 CDD:290151 41/49 (84%)
Kelch 1. {ECO:0000255} 76..125 40/49 (82%)
KELCH repeat 115..169 CDD:276965 39/54 (72%)
Kelch_3 124..180 CDD:290151 40/56 (71%)
Kelch 2. {ECO:0000255} 127..182 40/55 (73%)
Kelch_4 171..217 CDD:290154 33/48 (69%)
Kelch 3. {ECO:0000255} 184..235 34/53 (64%)
Kelch_3 234..289 CDD:290151 35/55 (64%)
Kelch 4. {ECO:0000255} 236..282 29/46 (63%)
Kelch_1 280..323 CDD:279660 30/95 (32%)
KELCH repeat 281..323 CDD:276965 29/94 (31%)
Kelch 5. {ECO:0000255} 292..338 33/98 (34%)
Kelch 6. {ECO:0000255} 396..447 16/51 (31%)
SPOP_C_like 571..631 CDD:269810 27/60 (45%)
BTB 662..761 CDD:279045 54/99 (55%)
BTB 665..762 CDD:197585 52/98 (53%)
SPOP_C_like 765..>804 CDD:269810


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C296312025
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H4925
Inparanoid 1 1.050 823 1.000 Inparanoid score I460
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1263405at2759
OrthoFinder 1 1.000 FOG0007486
OrthoInspector 1 1.000 T1082496
orthoMCL 1 0.900 OOG5_127972
Panther 1 1.100 LDO PTHR46376
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 1 0.960
1312.900

Return to query results.
Submit another query.