DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and klhdc4

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_001119902.1 Gene:klhdc4 ZFINID:ZDB-GENE-030131-2057 Length:585 Species:Danio rerio

Alignment Length:377 Identity:89/378 (24%)
Similarity:126/378 (33%) Gaps:161/378 (43%)


  Fly   224 ALNVDFTSYTATHQWTRMLECAEFVGAKRSKHTVVAY--KDAMFVFGGD--NGKN--MLNDLIRF 282
            ||..:|.|..|  :.|:::|.|....:.|...::.|:  ||.:.:|||:  |||.  :.|:|...
Zfish    38 ALIAEFQSLDA--KKTQVVETACAPPSPRLNASLCAHPEKDELILFGGEFFNGKKTFLYNELYFC 100

  Fly   283 GVKDKSWGRACATGTPPAPRYHHSAVV---AGSSMFIFGGYTGDIHSNSNLTNKNDLFEYKFQSA 344
            .:|..||.:|.....||. |....|||   .|..|::|||                         
Zfish   101 NIKKNSWVKADVPNPPPR-RCAQQAVVVPQGGGQMWVFGG------------------------- 139

  Fly   345 MWVEWKFSGRQPVPRSAHGAAVYDNKMWIYAGYDGNARLNDMWTLNLTGENQWEEVDQLGDRPPT 409
                 :|:       |..|...|..|              |:|.|                    
Zfish   140 -----EFA-------SPDGEQFYHYK--------------DLWVL-------------------- 158

  Fly   410 CCNFPVAVARDAMYVFSGQSGLQITNSLFEFHFKTRTWRRISNEPVLRGATSAP--PSRRYGHTM 472
                                           |..||||.::          .||  ||.|.||.|
Zfish   159 -------------------------------HLGTRTWEQV----------KAPGAPSGRSGHRM 182

  Fly   473 VHHDRFLYVFGGSADSTLP----NDLHCYDLDSQVWSVIQPE----------QNSDVPSGRVFHA 523
            |...|.|.||||..:||..    ||:|.::||:..||.:||.          |.:..|.|     
Zfish   183 VLSKRQLLVFGGFHESTRDYIYYNDVHAFNLDTFTWSRLQPTGTGPCPRSACQMTPTPDG----- 242

  Fly   524 SAVICDAMYIFGG----TVDNSVRRGDTYRFQFSSYPKCTLRDDFGKFFQDK 571
                 :.:.|:||    .....|.:|..:...|      .||.: ||..|:|
Zfish   243 -----NGVIIYGGYSKARAKKDVDKGTIHSDMF------LLRRE-GKEDQEK 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 78/346 (23%)
KELCH repeat 252..298 CDD:276965 16/52 (31%)
Kelch_3 261..310 CDD:290151 20/56 (36%)
Kelch_5 299..>329 CDD:290565 10/33 (30%)
KELCH repeat 302..355 CDD:276965 10/56 (18%)
Kelch_1 358..400 CDD:279660 7/42 (17%)
KELCH repeat 359..407 CDD:276965 7/48 (15%)
KELCH repeat 410..455 CDD:276965 5/45 (11%)
Kelch_1 410..452 CDD:279660 5/42 (12%)
Kelch_1 466..509 CDD:279660 21/47 (45%)
KELCH repeat 467..509 CDD:276965 21/46 (46%)
BTB 564..704 CDD:279045 4/9 (44%)
BTB 575..707 CDD:197585
SPOP_C_like 707..766 CDD:269810
BTB 798..898 CDD:279045
BTB 802..902 CDD:197585
SPOP_C_like 902..960 CDD:269810
klhdc4NP_001119902.1 Kelch_4 63..117 CDD:290154 17/54 (31%)
KELCH repeat 64..115 CDD:276965 16/51 (31%)
KELCH repeat 119..174 CDD:276965 24/167 (14%)
Kelch_3 131..184 CDD:290151 27/165 (16%)
KELCH repeat 177..226 CDD:276965 22/49 (45%)
Kelch_3 186..237 CDD:290151 18/51 (35%)
KELCH repeat 231..295 CDD:276965 15/70 (21%)
Kelch_4 297..344 CDD:290154
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.