DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and hcfc1a

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:XP_005169361.1 Gene:hcfc1a ZFINID:ZDB-GENE-030912-10 Length:1802 Species:Danio rerio

Alignment Length:469 Identity:106/470 (23%)
Similarity:177/470 (38%) Gaps:107/470 (23%)


  Fly   215 TSPGSYSCNALNVDFTSYTATHQWTRMLECAEFVGAKRSKHTVVAYKDAMFVFGGDNGKNMLNDL 279
            ||||....       |......:|.|:|..:..|...|..|..||.|:.|.||||.| :.::::|
Zfish     2 TSPGVPGT-------TGAPLQPRWKRVLGWSGPVPRPRHGHRAVAIKELMVVFGGGN-EGIVDEL 58

  Fly   280 IRFGVKDKSWGRACATGTPPAPRYHHSAVVAGSSMFIFGG------YTGDIHSNSNLTNKNDLFE 338
            ..:......|......|..|.....:..|..|:.:.:|||      |:.|:              
Zfish    59 HVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDL-------------- 109

  Fly   339 YKFQSAMWVEWK-------FSGRQPVPRSAHGAAVYDNKMWIYAGYDGNAR---------LNDMW 387
            |:.|::.| |||       .:|..|.||..|..::..||.:::.|...::.         |||::
Zfish   110 YELQASRW-EWKKLKPKAPKNGVPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLY 173

  Fly   388 TLNLTGENQ---WEEVDQLGDRPP-----TCCNFPVAVARDA-MYVFSGQSGLQITNSLFEFHFK 443
            ||.|...:.   |:.....|..||     |...:...|.:.: :.::.|.||.:: ..|:.....
Zfish   174 TLELRPGSSVAGWDVPVTYGVLPPPRESHTAVIYTEKVTKKSRLVIYGGMSGCRL-GDLWTLDID 237

  Fly   444 TRTWRRISNEPVLRGATSAPPSRRYGHTMVHHDRFLYVFGG--------------SADSTLPNDL 494
            |.||    |:|.:.||...|.|.....|:.:.   :|||||              ..:....|.|
Zfish   238 TLTW----NKPAISGAAPLPRSLHSATTITNK---MYVFGGWVPLVMDDVKVATHEKEWKCTNTL 295

  Fly   495 HCYDLDSQVW-SVIQPEQNSDVPSGRVFHASAVICDAMYIFGGTVDNSVRRGDTYRFQFSSYPKC 558
            .|.:||:..| :|:......::|..|..|.:..|.:.:||:.|                      
Zfish   296 ACLNLDTLAWETVLMDTLEDNIPRARAGHCAVAINNRLYIWSG---------------------- 338

  Fly   559 TLRDDFGKFFQDKQFCDIQFIVGAEEIRILAHIAFVAARSKYLRNK--ILAAREARQQQMEKVYG 621
              ||.:.|.:.::..|...:.:..|.....:.:..|.|.:..|...  .::..:....|::| |.
Zfish   339 --RDGYRKAWNNQVCCKDLWYLETERPNPPSRVQLVRANTNSLEVSWGAVSTADTYLLQLQK-YD 400

  Fly   622 VGQVDAL---ALNA 632
            :....|.   ||||
Zfish   401 IPAATAATSPALNA 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 85/363 (23%)
KELCH repeat 252..298 CDD:276965 14/46 (30%)
Kelch_3 261..310 CDD:290151 12/49 (24%)
Kelch_5 299..>329 CDD:290565 8/36 (22%)
KELCH repeat 302..355 CDD:276965 14/66 (21%)
Kelch_1 358..400 CDD:279660 13/54 (24%)
KELCH repeat 359..407 CDD:276965 13/60 (22%)
KELCH repeat 410..455 CDD:276965 10/46 (22%)
Kelch_1 410..452 CDD:279660 8/43 (19%)
Kelch_1 466..509 CDD:279660 13/58 (22%)
KELCH repeat 467..509 CDD:276965 13/57 (23%)
BTB 564..704 CDD:279045 14/75 (19%)
BTB 575..707 CDD:197585 12/64 (19%)
SPOP_C_like 707..766 CDD:269810
BTB 798..898 CDD:279045
BTB 802..902 CDD:197585
SPOP_C_like 902..960 CDD:269810
hcfc1aXP_005169361.1 PLN02153 12..332 CDD:177814 82/344 (24%)
Kelch_1 31..68 CDD:279660 12/38 (32%)
KELCH repeat 32..79 CDD:276965 15/48 (31%)
KELCH repeat 83..133 CDD:276965 14/65 (22%)
Kelch_3 90..144 CDD:290151 17/69 (25%)
KELCH repeat 199..252 CDD:276965 13/58 (22%)
Kelch_3 214..262 CDD:290151 14/53 (26%)
KELCH repeat 254..318 CDD:276965 14/67 (21%)
Kelch_3 263..329 CDD:290151 15/69 (22%)
Kelch_5 318..>350 CDD:290565 10/56 (18%)
FN3 <1624..1653 CDD:238020
FN3 1659..1763 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.