DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and KLHDC4

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:XP_006721264.1 Gene:KLHDC4 HGNCID:25272 Length:525 Species:Homo sapiens

Alignment Length:415 Identity:89/416 (21%)
Similarity:145/416 (35%) Gaps:150/416 (36%)


  Fly   298 PPAPRYHHSAVV--AGSSMFIFGGYTGDIHSNSNLTNKNDLFEYKFQSAMWVEWKFSGRQPVPRS 360
            ||:||.:.|..|  ....:.:|||                  ||           |:|:      
Human    60 PPSPRLNASLSVHPEKDELILFGG------------------EY-----------FNGQ------ 89

  Fly   361 AHGAAVYDNKMWIYAGYDGNARLNDMWTLNLTGENQWEEVDQLGDRPPTCCNFPVAVARDA--MY 423
                     |.::|         |:::..| |.::.|.:||.....|..|.:..|.|.:..  ::
Human    90 ---------KTFLY---------NELYVYN-TRKDTWTKVDIPSPPPRRCAHQAVVVPQGGGQLW 135

  Fly   424 VFSGQ----SGLQITN--SLFEFHFKTRTWRRISNEPVLRGATSAPPSRRYGHTMVHHDRFLYVF 482
            ||.|:    :|.|..:  .|:..|..|:||.:::   :....::..||.|.||.||...|.|.:|
Human   136 VFGGEFASPNGEQFYHYKDLWVLHLATKTWEQVN---LFHFRSTGGPSGRSGHRMVAWKRQLILF 197

  Fly   483 GGSADSTLP----NDLHCYDLDSQVWSVIQPEQNSDVP-SGRVFHASAVICDAMYIFGG------ 536
            ||..:||..    ||::.::||:..||.:.|......| ||  ...|......:.::||      
Human   198 GGFHESTRDYIYYNDVYAFNLDTFTWSKLSPSGTGPTPRSG--CQMSVTPQGGIVVYGGYSKQRV 260

  Fly   537 --TVDNSVRRGDTYRFQ--------------FSSYPKCTLRDDF--------------------- 564
              .||...|..|.:..:              ..|..|.|.|..|                     
Human   261 KKDVDKGTRHSDMFLLKPEDGREDKWVWTRMNPSGVKPTPRSGFSVAMAPNHQTLFFGGVCDEEE 325

  Fly   565 -----GKFFQDKQFCDIQFIVGAEEIRILAHIAFVAARSKYLRNKILA----AREARQQQMEKVY 620
                 |:||.|..|.|                   |.|:::...::..    .::.|:.:.|:..
Human   326 EESLSGEFFNDLYFYD-------------------ATRNRWFEGQLKGPKSEKKKRRRGRKEEPE 371

  Fly   621 GVGQVDALALNAGAGGDRGPMLEVR 645
            | |...|    .|..|.:||:..|:
Human   372 G-GSRPA----CGGAGTQGPVQLVK 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 66/293 (23%)
KELCH repeat 252..298 CDD:276965 89/416 (21%)
Kelch_3 261..310 CDD:290151 6/14 (43%)
Kelch_5 299..>329 CDD:290565 8/32 (25%)
KELCH repeat 302..355 CDD:276965 10/55 (18%)
Kelch_1 358..400 CDD:279660 6/42 (14%)
KELCH repeat 359..407 CDD:276965 8/48 (17%)
KELCH repeat 410..455 CDD:276965 13/53 (25%)
Kelch_1 410..452 CDD:279660 13/50 (26%)
Kelch_1 466..509 CDD:279660 18/47 (38%)
KELCH repeat 467..509 CDD:276965 18/46 (39%)
BTB 564..704 CDD:279045 19/113 (17%)
BTB 575..707 CDD:197585 13/76 (17%)
SPOP_C_like 707..766 CDD:269810
BTB 798..898 CDD:279045
BTB 802..902 CDD:197585
SPOP_C_like 902..960 CDD:269810
KLHDC4XP_006721264.1 KELCH repeat 64..115 CDD:276965 18/105 (17%)
PLN02193 <77..319 CDD:330882 65/301 (22%)
KELCH repeat 119..179 CDD:276965 13/63 (21%)
KELCH repeat 182..231 CDD:276965 19/49 (39%)
KELCH repeat 236..298 CDD:276965 11/64 (17%)
KELCH repeat 437..485 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.