DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and FBXO42

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_061867.1 Gene:FBXO42 HGNCID:29249 Length:717 Species:Homo sapiens

Alignment Length:389 Identity:85/390 (22%)
Similarity:136/390 (35%) Gaps:104/390 (27%)


  Fly   193 CSMAYDAASNASSGSGSGSGKATSPGSYSCNALNVDFTSYTATHQWTRMLECAEFVGAKRSKHTV 257
            |...|......:.....|..||...|       |:.:.|.|..:..|.:        .:|..|:.
Human    75 CKQWYRLIKGVAHQCYHGFMKAVQEG-------NIQWESRTYPYPGTPI--------TQRFSHSA 124

  Fly   258 VAY--KDAMFVFGG---DNGKNMLNDLIRFGVKDKSWGRACATGTPPAPRYHHSAVVAGSSMFIF 317
            ..|  ..:|:||||   .:.....|||.|..:..|.|.|..|:|:.|:|:...:.||....:.:|
Human   125 CYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLVVYKDLLVLF 189

  Fly   318 GGYT--------------GDIHSNSNLTNKNDLFEYKFQSAMWVEWKFSGRQPVPRSAHGAAVYD 368
            ||:|              .:||:.|  .:||           |.....:...|.|.:.|.:.|.|
Human   190 GGWTRPSPYPLHQPERFFDEIHTYS--PSKN-----------WWNCIVTTHGPPPMAGHSSCVID 241

  Fly   369 NKMWIYAGYDGNARL-NDMWTLNLTGENQWEEVDQLGDRP-PTCCNFPVAVARDAMYVFSGQSGL 431
            :||.::.|..|:.:: ||:|.|:|. :..|.:.:..|..| |......:.:....:.:..|..| 
Human   242 DKMIVFGGSLGSRQMSNDVWVLDLE-QWAWSKPNISGPSPHPRGGQSQIVIDDATILILGGCGG- 304

  Fly   432 QITNSLFE----FHFKTRTWR----RISNEPVLRGATS--APPSRRYGHTMVHHDRFLYVFGGSA 486
              .|:||:    .|..:..|.    ::.||.  .||..  ..|:.|.|..:|       ||..:.
Human   305 --PNALFKDAWLLHMHSGPWAWQPLKVENEE--HGAPELWCHPACRVGQCVV-------VFSQAP 358

  Fly   487 DSTLP--------------------NDLHCYDLDSQV------------WSVIQPEQNSDVPSG 518
            ....|                    .:...|...|.|            |..::|......|||
Human   359 SGRAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTPSG 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 76/346 (22%)
KELCH repeat 252..298 CDD:276965 17/51 (33%)
Kelch_3 261..310 CDD:290151 18/52 (35%)
Kelch_5 299..>329 CDD:290565 11/44 (25%)
KELCH repeat 302..355 CDD:276965 12/67 (18%)
Kelch_1 358..400 CDD:279660 14/43 (33%)
KELCH repeat 359..407 CDD:276965 14/49 (29%)
KELCH repeat 410..455 CDD:276965 9/53 (17%)
Kelch_1 410..452 CDD:279660 7/50 (14%)
Kelch_1 466..509 CDD:279660 10/75 (13%)
KELCH repeat 467..509 CDD:276965 10/74 (14%)
BTB 564..704 CDD:279045
BTB 575..707 CDD:197585
SPOP_C_like 707..766 CDD:269810
BTB 798..898 CDD:279045
BTB 802..902 CDD:197585
SPOP_C_like 902..960 CDD:269810
FBXO42NP_061867.1 F-box-like 47..>82 CDD:315592 2/7 (29%)
KELCH repeat 119..168 CDD:276965 16/49 (33%)
Kelch_3 130..182 CDD:315978 18/52 (35%)
Kelch 1 132..184 18/52 (35%)
KELCH repeat 174..229 CDD:276965 12/68 (18%)
Kelch_3 183..240 CDD:315978 14/70 (20%)
Kelch 2 186..242 15/69 (22%)
Guanylate_kin 228..>360 CDD:331880 35/145 (24%)
Kelch_5 229..268 CDD:316377 14/40 (35%)
KELCH repeat 232..271 CDD:276965 13/40 (33%)
Kelch 3 244..293 12/50 (24%)
Kelch 4 295..342 11/52 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.