DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and slim

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_523782.1 Gene:slim FlyBaseID:FBgn0261477 Length:609 Species:Drosophila melanogaster

Alignment Length:633 Identity:120/634 (19%)
Similarity:213/634 (34%) Gaps:212/634 (33%)


  Fly   216 SPGSYSCNALNVDFTSYTATHQWTRMLECAEFVGAKRSKHTVVAYKDAMFVFGGDNGKNMLNDLI 280
            :||.:.|...:      ...|.||.:|...:|:........:.|:::.:.....:|..|  ||||
  Fly     5 NPGKFKCIVFD------QLRHTWTFLLFICDFLAKIYRTPRITAHQEQLANHNNNNNNN--NDLI 61

  Fly   281 -RFGVKDKSWGRACATGTPPAPRYHHSAVV--------------AGSSM-----------FIFGG 319
             ...:.::..|:.    ....|:..:..||              |.|.:           .:...
  Fly    62 MEQDMPEEEVGQP----EEALPQQDNGEVVDRFNAIQAAVELMDAASDLDEEEEEEDDDVDVDVD 122

  Fly   320 YTGDIHSNSNL--------TNKNDLFE-----------------------------YKFQSAMWV 347
            | ||..|.|..        |:.:|..:                             |.||....|
  Fly   123 Y-GDTDSESEFEEMYSDEWTSSSDELDEGTELSKSVLNVFLSSDKQQSQMAGQIPMYAFQPLRLV 186

  Fly   348 EWKF-----SGRQPVPRSAHGAAVYDNKMWIYAGYDGNARLN-----------DMWTLNLTGENQ 396
            :.::     .|..|:.||.|.....::.::...||:..:.::           ::|:.|. ....
  Fly   187 KCQYRDKHIPGGFPLARSGHRIIASNSHLYSLGGYNPRSAMSASRHGRCLLFQELWSYNF-ATRT 250

  Fly   397 WEEVDQLGDRPPTCCNFPVAVARDAMYVFSG----------QSGLQITNSLFEFHFKTRTWRRIS 451
            |......|:    ..|.||.:|.:|:.:.:.          ..|:..:|..:.:    ||     
  Fly   251 WRLELNAGN----AANMPVELASNALTIHNNVLISHGGTGYPFGVSCSNDCYVY----RT----- 302

  Fly   452 NEPVLRGATSAP---------PSRRYGHTMVHHDRFLYVFGGSADSTLPNDLHCYDLDSQVWS-- 505
               ...|||...         |:.:||..:|.|..|||..||:.......|::..||.:.:|.  
  Fly   303 ---ASAGATPGVDRLQVKGDLPTAQYGPGIVIHKHFLYTIGGTTGFDYTCDVYRLDLRTGIWENV 364

  Fly   506 -VIQPEQNSDVPSGRVFHASAVICDAMYIF--GGTVDNSV---RRGDTYRFQ------FSSYP-- 556
             :.:||...| |.||..|  .|:.|..:||  ||...:||   :|...|..:      |.:||  
  Fly   365 YISRPEMRDD-PEGRYRH--EVVYDGKHIFVLGGGTSHSVYDLQRIPAYNLEANCWDYFETYPDQ 426

  Fly   557 KCTLRDDFGKFFQDKQFC-----------DIQ-FIVG---AEEIRILAHIAFVAARSKY---LRN 603
            :....||..:.:...:.|           ||: ||.|   .:.....:.|..:..|:|:   :..
  Fly   427 RAADADDGNRGYPKPRKCFSCVQHQSSTGDIEAFITGGLQGDFSTYFSDIWKLNLRTKHWYRIET 491

  Fly   604 KILAAREARQQQMEKVYGVGQVDALALNAGAGGDRGPMLEVRLANASPEAFEIILNYIY--TDRI 666
            .||..                  .|..::.|..|.|.|                  |::  .:.|
  Fly   492 AILPR------------------PLYFHSAAHSDNGCM------------------YVFGGIEYI 520

  Fly   667 DLKDTYSKNIIILITDIYQLAGLFTMPRLAHGCIQYLDYKINKLNVLE 714
            | |:...:|      |:|::  ..|:|:|:..|...:.|..:.|::.:
  Fly   521 D-KEMRRRN------DLYKM--WMTVPKLSEMCWDAITYYNDNLDLYD 559

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 83/429 (19%)
KELCH repeat 252..298 CDD:276965 8/47 (17%)
Kelch_3 261..310 CDD:290151 10/64 (16%)
Kelch_5 299..>329 CDD:290565 10/55 (18%)
KELCH repeat 302..355 CDD:276965 16/120 (13%)
Kelch_1 358..400 CDD:279660 8/53 (15%)
KELCH repeat 359..407 CDD:276965 9/59 (15%)
KELCH repeat 410..455 CDD:276965 9/55 (16%)
Kelch_1 410..452 CDD:279660 9/52 (17%)
Kelch_1 466..509 CDD:279660 13/46 (28%)
KELCH repeat 467..509 CDD:276965 13/45 (29%)
BTB 564..704 CDD:279045 27/160 (17%)
BTB 575..707 CDD:197585 27/141 (19%)
SPOP_C_like 707..766 CDD:269810 1/9 (11%)
BTB 798..898 CDD:279045
BTB 802..902 CDD:197585
SPOP_C_like 902..960 CDD:269810
slimNP_523782.1 KELCH repeat 203..263 CDD:276965 10/65 (15%)
KELCH repeat 267..321 CDD:276965 9/66 (14%)
KELCH repeat 324..364 CDD:276965 13/40 (33%)
Kelch_1 325..372 CDD:279660 15/47 (32%)
Kelch_4 441..492 CDD:290154 9/51 (18%)
KELCH repeat 442..495 CDD:276965 11/53 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122488374
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.