DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and tea1

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_588351.1 Gene:tea1 PomBaseID:SPCC1223.06 Length:1147 Species:Schizosaccharomyces pombe

Alignment Length:1035 Identity:212/1036 (20%)
Similarity:365/1036 (35%) Gaps:280/1036 (27%)


  Fly   171 GGAASSSHPPGSSCSSGPGGSGCSMAYDAASNASSG---------SGSGSGKATSPGSYSCNALN 226
            |.|...:.|..|..|:.|..|....::::....|:.         :||||....||         
pombe    10 GSAHKPTKPNFSKTSTTPSTSQLKHSHESNVKMSTSTVTEHRKKPTGSGSHITASP--------- 65

  Fly   227 VDFTSYTATHQWTRMLECAEFVGAKRSKHTVVAYKDA---MFVFGG-DNGKNMLNDLIRFGVKDK 287
                       |:::..........|..|....|.:.   :::||| .:.....|||....:...
pombe    66 -----------WSKLTVRGSSNVLPRYSHASHLYAEGGQEIYIFGGVASDSQPKNDLWVLNLATS 119

  Fly   288 SWGRACATGTPPAPRYHHSAVVAGSSMFIFGGYTGDIHSNSNLTNK--NDLFEYKFQSAMWVEWK 350
            .:....:.|..|:||..|::::.|::..:|||.|     |.::.::  |.|:.....|.:|.:..
pombe   120 QFTSLRSLGETPSPRLGHASILIGNAFIVFGGLT-----NHDVADRQDNSLYLLNTSSLVWQKAN 179

  Fly   351 FSGRQPVPRSAHGAAVYDNKMWIYAGYDGNARLNDMWTLNL----TGENQWEEVDQLGDRPPTCC 411
            .||.:|..|..|..:...:|:.::.|...:...||:...:|    |.:::||....:.|.||...
pombe   180 ASGARPSGRYGHTISCLGSKICLFGGRLLDYYFNDLVCFDLNNLNTSDSRWELASVVNDPPPARA 244

  Fly   412 NFPVAVARDAMYVFSGQSGLQITNSLFEFHFKTRTWRRISNEPVLRGATSAPPSRRYGHTMVHHD 476
            ........|.:|:|.|..|....|.|:.:|.|...|.::....|       .|:.|.||.....:
pombe   245 GHVAFTFSDKLYIFGGTDGANFFNDLWCYHPKQSAWSKVETFGV-------APNPRAGHAASVVE 302

  Fly   477 RFLYVFGGSA-DSTLPNDLHCYDLDSQVWSVIQPEQNSDV---PSGRVFHASAVICDAMYIFG-- 535
            ..||||||.| |.|..|||:.:.|.|:.|..:     ||:   ||.|..|..:.....:.:.|  
pombe   303 GILYVFGGRASDGTFLNDLYAFRLSSKHWYKL-----SDLPFTPSPRSSHTLSCSGLTLVLIGGK 362

  Fly   536 ---GTVDNSVRRGDTYRFQFSSYPKCTLRDDFGKFFQDKQFCDIQFIVG---------------- 581
               |..|::|...||.||:..|.|..:.|.....||.:.        .|                
pombe   363 QGKGASDSNVYMLDTSRFRLGSVPTTSGRQRNTSFFSNS--------TGNTNPSAFNGLLTSSRI 419

  Fly   582 ----AEEIRILAHIAFVAARSKY--------------------------LRNKILAAREARQQQM 616
                ..::|..:|    .:|.:|                          |.:.::..|......:
pombe   420 PSYNGSKVRSTSH----PSRQQYIGSSNSRFNTRHQTISTPVSGRASNDLPSPVVPTRSNSSSIL 480

  Fly   617 EKVYGV----------GQVDALALN-------AGAGGDRGPMLE---------------VRLANA 649
            :..|.:          ...|..:||       |.|.|:..|.|.               ....||
pombe   481 QPSYNLNSHSSDRRNTNDDDQSSLNSQQLSNQAKAQGEVSPTLSFVPSSHSMEQGNGSVASANNA 545

  Fly   650 SPEAFEIILNYI-------YTDRIDLKDT-YSKNIIILITDI--------------YQLAGLF-- 690
            ..||....:|.|       :.::..:|.. ..|::...||.:              .|:...|  
pombe   546 QSEAATRSINSISEVSEVRFPEQSSVKTVDERKSLDGRITSVTLETLVEKYSELSKQQIVEWFKS 610

  Fly   691 TMPRLAHGCIQYLDYKINKLNVLEALYNA--------------------------DKSNIKIIKD 729
            .:..:.......:|....||.|..|..||                          ||.|::...|
pombe   611 KLYEILRDSASKIDSLTEKLKVANAEKNAALCEAALEKVPLAKHNKLSDGTFSTPDKENVQSTND 675

  Fly   730 -HCMQFIIKEENFT----DVVMSSEFSDLDKPLLVE-------IIRKRLYPSKLVIDTSYEGNIG 782
             |.||     |||:    ..||....|||||.|...       |::...:..:||.:......|.
pombe   676 AHIMQ-----ENFSLHKALEVMRETSSDLDKQLKDATASQKELIVQTSSFQKELVEERERHNAIS 735

  Fly   783 TTLEIDLCAFLESTGKDFCDISLVLEDHVIPAHKSVLSSRCTYFQGMFRS-FMPPDNTVNIQIGE 846
            ..|:     .:||..:|...:...|||.::  .::|..::..:.:..||. .|..:||:.    :
pombe   736 KRLQ-----EIESLYRDRELLVTNLEDQLV--DQTVTINKFAFERDQFRERSMGFENTIK----D 789

  Fly   847 ISPSLEA-------FHSLLRYIYYGETKMPPQDALYLFQAPCFYGLANNRLHAFCKYSLEHNITF 904
            ::..:||       .|..||.:....:::..:.||...:......:.:...:.:.|.:.:|. .:
pombe   790 LTRKMEATDMLNVSLHESLRSVQTENSELVTEMALLKAELVKKQAIIDANANIYDKLTADHT-NY 853

  Fly   905 ENVLQTLEASDITKIYDIKEYALKLI--VKDF----------------AKVARLPKIAGLSR--- 948
            |.|     ::||.:  ::||...||:  ..||                ||:.:..|:...|:   
pombe   854 ETV-----SADINQ--NLKETLDKLLNGSSDFKNNEIELLHDQIRITNAKLEKREKLINASKYIE 911

  Fly   949 ELLLEIIRAVAD--SHGEF----LTRININTDIXKLVLLQP----ALQLLLAWLQIGRST 998
            :.|...|:..|:  |:.||    |...|.|..: .:..|:.    |.||:...:|:..:|
pombe   912 DTLRSEIQEAAEKVSNLEFSNFNLKEENSNMQLQLMKALEQRNTGAKQLVNLRMQLSTAT 971

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 85/336 (25%)
KELCH repeat 252..298 CDD:276965 10/50 (20%)
Kelch_3 261..310 CDD:290151 11/53 (21%)
Kelch_5 299..>329 CDD:290565 10/30 (33%)
KELCH repeat 302..355 CDD:276965 14/55 (25%)
Kelch_1 358..400 CDD:279660 10/46 (22%)
KELCH repeat 359..407 CDD:276965 11/52 (21%)
KELCH repeat 410..455 CDD:276965 10/45 (22%)
Kelch_1 410..452 CDD:279660 10/42 (24%)
Kelch_1 466..509 CDD:279660 18/44 (41%)
KELCH repeat 467..509 CDD:276965 18/43 (42%)
BTB 564..704 CDD:279045 30/242 (12%)
BTB 575..707 CDD:197585 29/234 (12%)
SPOP_C_like 707..766 CDD:269810 25/97 (26%)
BTB 798..898 CDD:279045 18/108 (17%)
BTB 802..902 CDD:197585 18/108 (17%)
SPOP_C_like 902..960 CDD:269810 17/79 (22%)
tea1NP_588351.1 KELCH repeat 80..131 CDD:276965 10/51 (20%)
Kelch_3 92..142 CDD:290151 11/50 (22%)
KELCH repeat 134..181 CDD:276965 12/52 (23%)
Kelch_3 143..194 CDD:290151 15/56 (27%)
Kelch_2 187..236 CDD:284956 10/49 (20%)
KELCH repeat 188..239 CDD:276965 11/51 (22%)
Kelch_1 242..287 CDD:279660 10/45 (22%)
KELCH repeat 243..290 CDD:276965 11/54 (20%)
Kelch_4 292..338 CDD:290154 20/51 (39%)
KELCH repeat 293..338 CDD:276965 20/50 (40%)
SbcC 594..>1121 CDD:223496 82/403 (20%)
ATP-synt_B <608..726 CDD:304375 29/123 (24%)
RILP-like <866..952 CDD:304877 19/86 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.