DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and Klhdc4

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_663580.2 Gene:Klhdc4 MGIID:2384569 Length:584 Species:Mus musculus

Alignment Length:283 Identity:65/284 (23%)
Similarity:118/284 (42%) Gaps:46/284 (16%)


  Fly   261 KDAMFVFGGD--NGKN--MLNDLIRFGVKDKSWGRACATGTPPAPRYHHSAVV---AGSSMFIFG 318
            ||.:.:|||:  ||:.  |.|:|..:.::..:|.:....|.||. |..|.|||   .|..:::||
Mouse    75 KDELILFGGEYFNGQKTFMYNELYIYSIRKDTWTKVDIPGPPPR-RCAHQAVVVPQGGGQLWVFG 138

  Fly   319 GYTGDIHSNSNLTNKNDLFEYKFQSAMWVEWKFSGRQPVPRSAHGAAVYDNKMWIYAGYDGNAR- 382
            |.... .......:..||:.....:..|.:.:.:| .|..||.|....:..::.::.|:..:|| 
Mouse   139 GEFAS-PDGEQFYHYKDLWVLHLATKTWEQIRSTG-GPSGRSGHRMVAWKRQLILFGGFHESARD 201

  Fly   383 ---LNDMWTLNLTGENQWEEVDQLGDRPPTCCNFPVAVA-RDAMYVFSGQSGLQITNSLFE---- 439
               .:|::|.:| ...||.::...|..|.......:||. :.::.::.|.|..::...:.:    
Mouse   202 YIYYSDVYTFSL-DTFQWSKLSPSGPGPTPRSGCLMAVTPQGSIAIYGGYSKQRVKKDVDKGTQH 265

  Fly   440 ---FHFKTR-------TWRRISNEPVLRGATSAPPSRRYGHTM-VHHDRFLYVFGG--------S 485
               |..|..       .|.||:       .:...|:.|.|.:: |..:..:.||||        |
Mouse   266 SDMFLLKPAEGGEGKWAWTRIN-------PSGVKPTARSGFSVAVAPNHQILVFGGVCDEEEEES 323

  Fly   486 ADSTLPNDLHCYDLDSQVWSVIQ 508
            .:.:..:||:.||.....|...|
Mouse   324 LEGSFFSDLYIYDSAKSRWFAAQ 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 65/284 (23%)
KELCH repeat 252..298 CDD:276965 12/41 (29%)
Kelch_3 261..310 CDD:290151 19/56 (34%)
Kelch_5 299..>329 CDD:290565 10/33 (30%)
KELCH repeat 302..355 CDD:276965 13/56 (23%)
Kelch_1 358..400 CDD:279660 11/46 (24%)
KELCH repeat 359..407 CDD:276965 12/52 (23%)
KELCH repeat 410..455 CDD:276965 9/60 (15%)
Kelch_1 410..452 CDD:279660 9/57 (16%)
Kelch_1 466..509 CDD:279660 14/53 (26%)
KELCH repeat 467..509 CDD:276965 14/52 (27%)
BTB 564..704 CDD:279045
BTB 575..707 CDD:197585
SPOP_C_like 707..766 CDD:269810
BTB 798..898 CDD:279045
BTB 802..902 CDD:197585
SPOP_C_like 902..960 CDD:269810
Klhdc4NP_663580.2 KELCH repeat 64..115 CDD:276965 12/40 (30%)
Kelch_3 75..127 CDD:290151 19/53 (36%)
Kelch 1 77..129 17/53 (32%)
KELCH repeat 119..174 CDD:276965 13/57 (23%)
Kelch_3 131..185 CDD:290151 12/56 (21%)
Kelch 2 133..187 11/56 (20%)
Kelch_5 174..216 CDD:290565 10/43 (23%)
KELCH repeat 177..223 CDD:276965 11/47 (23%)
Kelch 3 188..238 11/51 (22%)
KELCH repeat 231..293 CDD:276965 9/69 (13%)
Kelch 4 243..289 7/53 (13%)
Kelch 5 308..361 11/40 (28%)
Kelch_1 431..480 CDD:279660
KELCH repeat 432..480 CDD:276965
Kelch 6 443..494
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.