DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and Rabepk

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_663497.2 Gene:Rabepk MGIID:2139530 Length:380 Species:Mus musculus

Alignment Length:364 Identity:88/365 (24%)
Similarity:145/365 (40%) Gaps:47/365 (13%)


  Fly   188 PGGSGCSMAYDAASNASSGSGSGSGKATSPGSYSCNALNVD-FTSYTATHQW---TR-----MLE 243
            ||...|.....:.|.......:.|||....|..:.|....| .|....||||   ||     ..|
Mouse    32 PGDRPCPRVGHSCSYFPPVGDAESGKIFIVGGANPNQSFSDVHTMDLGTHQWDTATREGLLPRYE 96

  Fly   244 CAEFVGAKRSKHTVVAYKDAMFVFGGDNGKNMLNDLIRFGVKDKSWGRACATGTPPAPR-YHHSA 307
            .|.|: ...|.|::       :||||.:.....|.|.....:|::|.....||:||:|| :|.|:
Mouse    97 HASFL-PSCSPHSI-------WVFGGADQSGNRNCLQVMSPEDRTWSTPEVTGSPPSPRTFHTSS 153

  Fly   308 VVAGSSMFIFGGYTGDIHSNSNLTNKNDLFEYKFQSAMWVEWKFSGRQPVPRSAHGAAVYDNKMW 372
            ...|:.:::|||  |:  ..:.......|..:...:..|.:.:..|..|.||..|.......|::
Mouse   154 AAIGNQLYVFGG--GE--RGAQPVEDVKLHVFDANTLTWSQPETHGSPPSPRHGHVMVAAGTKLF 214

  Fly   373 IYAGYDGNARLNDMWTLNLTGENQWEEVDQLGDRPPTCCNFPVAVARDAMYVFSGQSGLQITNSL 437
            |:.|..|:...:|:..::: |:..|:::...|..|..|...........:|:|.|.:.....|.:
Mouse   215 IHGGLAGDKFFDDLHCIDI-GDMSWQKLGPTGAVPVGCAAHAAVAVGHHVYMFGGMTATGALNMM 278

  Fly   438 FEFHFKTRTWRRISNEPVLRGATSAPPSRRYGHTMVHHDRFLYVFGGSADSTLPNDLHCYDLDSQ 502
            :::|.:.:.|      .||:..||.|..|.        |..:.|......||..|.    |.||.
Mouse   279 YKYHTEKQHW------TVLQFDTSLPAGRL--------DHSMCVIPWPVMSTSENK----DSDSV 325

  Fly   503 VWSVIQPE-----QNSDVPSGRVFHASAVICDAMYIFGG 536
            :.: :|.|     :.::..||.....|.......::|||
Mouse   326 ILT-LQDEKGDAAEKAETQSGGPHEESPTTVLLCFVFGG 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 75/315 (24%)
KELCH repeat 252..298 CDD:276965 12/46 (26%)
Kelch_3 261..310 CDD:290151 16/50 (32%)
Kelch_5 299..>329 CDD:290565 10/31 (32%)
KELCH repeat 302..355 CDD:276965 11/54 (20%)
Kelch_1 358..400 CDD:279660 10/42 (24%)
KELCH repeat 359..407 CDD:276965 10/48 (21%)
KELCH repeat 410..455 CDD:276965 7/45 (16%)
Kelch_1 410..452 CDD:279660 7/42 (17%)
Kelch_1 466..509 CDD:279660 10/43 (23%)
KELCH repeat 467..509 CDD:276965 9/42 (21%)
BTB 564..704 CDD:279045
BTB 575..707 CDD:197585
SPOP_C_like 707..766 CDD:269810
BTB 798..898 CDD:279045
BTB 802..902 CDD:197585
SPOP_C_like 902..960 CDD:269810
RabepkNP_663497.2 Kelch_3 56..101 CDD:290151 15/45 (33%)
Kelch 1 57..103 14/47 (30%)
KELCH repeat 94..143 CDD:276965 15/57 (26%)
Kelch_3 107..155 CDD:290151 17/55 (31%)
Kelch 2 108..154 16/53 (30%)
KELCH repeat 147..198 CDD:276965 11/55 (20%)
Kelch_3 157..209 CDD:290151 12/56 (21%)
Kelch 3 159..211 11/56 (20%)
Kelch_1 200..243 CDD:279660 10/44 (23%)
KELCH repeat 201..243 CDD:276965 9/43 (21%)
Kelch 4 212..258 10/47 (21%)
KELCH repeat 251..291 CDD:276965 8/46 (17%)
Kelch 5 262..311 14/63 (22%)
Kelch 264..309 CDD:128874 14/59 (24%)
Kelch 6 357..380 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.