DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and F53E4.1

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_001355431.1 Gene:F53E4.1 WormBaseID:WBGene00009978 Length:432 Species:Caenorhabditis elegans

Alignment Length:360 Identity:91/361 (25%)
Similarity:139/361 (39%) Gaps:88/361 (24%)


  Fly   238 WTRMLECAEFVGAKRSKHTVVAYKDAMFVFGG------DNGKNML-------------------- 276
            ||..||    .|.:|..|..:|....::.|||      .:.|:.|                    
 Worm    10 WTVHLE----GGPRRVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLNTENYRWIKMNPGYV 70

  Fly   277 --NDLIR-------FGVKDKSWGRACATGTPPAPRYHHSAVVAGSSMFIFGGYTGDIHSNSNLTN 332
              |.:|.       :...||.:|..      |..||.|:.|......:::||...| :...||  
 Worm    71 YNNRIITKATIESPYSDSDKMFGAV------PYQRYGHTVVEYQGKAYVWGGRNDD-YGACNL-- 126

  Fly   333 KNDLFEYKFQSAMWVEWKFSGRQPVPRSAHGAAVYDNKMWIYAGYDGNARLNDMWTLNLT-GENQ 396
               |.||..:..:|.:.:..|..|..|..|.|.|::|:|:::.||:.:|:.....|.... ..:.
 Worm   127 ---LHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFATST 188

  Fly   397 WEEVDQLGDRPPTCCNFPVAVARDA-MYVFSGQSGL---------------QITNSLFEFHFKTR 445
            |.|:....| ||...:|..|...|. ||:|.|:|..               |..::|...:..|.
 Worm   189 WREMHTKND-PPRWRDFHTASVIDGMMYIFGGRSDESGQVGDEHLFHTIHDQYDDTLMALNLATG 252

  Fly   446 TWRRISNEPVLRGATSAP-----PSRRYGHTMVHHDRFLYVFGG--SADSTLPNDLHCYDLDSQV 503
            .|.|          |..|     |..|..|:...:|..:|:|||  ...:...|:|:|:|..:.:
 Worm   253 AWTR----------TKVPENTMKPGGRRSHSTWVYDGKMYMFGGYLGTINVHYNELYCFDPKTSM 307

  Fly   504 WSVIQPEQNSDVPSGRVFHASAVICDAMYIFGGTV 538
            ||||  ......||.|..|.|.|....:|:||||:
 Worm   308 WSVI--SVRGTYPSARRRHCSVVSNGKVYLFGGTM 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 91/361 (25%)
KELCH repeat 252..298 CDD:276965 13/81 (16%)
Kelch_3 261..310 CDD:290151 15/84 (18%)
Kelch_5 299..>329 CDD:290565 8/30 (27%)
KELCH repeat 302..355 CDD:276965 14/53 (26%)
Kelch_1 358..400 CDD:279660 12/43 (28%)
KELCH repeat 359..407 CDD:276965 13/49 (27%)
KELCH repeat 410..455 CDD:276965 13/61 (21%)
Kelch_1 410..452 CDD:279660 13/58 (22%)
Kelch_1 466..509 CDD:279660 15/45 (33%)
KELCH repeat 467..509 CDD:276965 15/44 (34%)
BTB 564..704 CDD:279045
BTB 575..707 CDD:197585
SPOP_C_like 707..766 CDD:269810
BTB 798..898 CDD:279045
BTB 802..902 CDD:197585
SPOP_C_like 902..960 CDD:269810
F53E4.1NP_001355431.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.