DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and hcf-1

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_501279.1 Gene:hcf-1 WormBaseID:WBGene00001827 Length:782 Species:Caenorhabditis elegans

Alignment Length:380 Identity:87/381 (23%)
Similarity:144/381 (38%) Gaps:122/381 (32%)


  Fly   252 RSKHTVVAYKDAMFVFGGDNGKNMLNDLIRFGVKDKSWGRACATGTPPAPRYHHSAVVAGSSMFI 316
            |..|..|..|:.:.:|||.| :.|:::|..:..:.:.|......|..|.|.....|:..|:.::.
 Worm    44 RHGHRAVVLKELIVIFGGGN-EGMIDELHAYNTQKREWTAPQCCGDVPTPAAAFGAISLGNKIYR 107

  Fly   317 FGG------YTGDIHSNSNLTNKNDLFEYKFQSAMWVEWK-------FSGRQPVPRSAHGAAV-- 366
            |||      ||.|:              |:.||..| ||:       .:|..|.||..|...|  
 Worm   108 FGGMTEYGKYTNDL--------------YELQSTRW-EWRRLNPRVHSNGHLPCPRIGHSFVVSQ 157

  Fly   367 YDNKMWIYAGYDGNAR---------LNDMWTLNLTGENQ--WEEVDQLGDRPPTCCNFPVAVARD 420
            ...|.:::.|...:..         |:|::.:||:|...  ||:::..|..|         ::|:
 Worm   158 KSQKAYVFGGLSNDLNDPKRNVPHYLDDLYVINLSGPQHLIWEKLNATGPGP---------ISRE 213

  Fly   421 A-------------MYVFSGQSGLQITNSLFEFHFKTRTWRRIS-NEPVLRGATSAPPSRRYGHT 471
            :             |.|:.|.:|::: ..|:..:..|..|..|. ::|    .|..||..|..|:
 Worm   214 SHTAVIYEKDSISRMVVYGGMNGVRL-GDLWYLNLNTLHWTEIKFDDP----RTGIPPMPRSLHS 273

  Fly   472 MVHHDRFLYVFGG-----------------------------SADSTLPNDLHCYDLDSQVWSVI 507
            .|.....::|:||                             :.|..:|..|:|.|.|:      
 Worm   274 SVLIGDKMFVYGGWVPLLEHASTEQQTEKEWKCTSSLGCWNITEDRWVPLHLYCSDEDT------ 332

  Fly   508 QPEQNSDVPSGRVFHASAVICDAMYIFGGTVDNSVRRGDTYRFQFSSYPKCTLRD 562
                   :|.||..|.:|.:.|.|||:.|.        |.||..:|:...|  ||
 Worm   333 -------IPRGRAGHCAAAVGDRMYIWSGR--------DGYRKAWSNQVCC--RD 370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 84/371 (23%)
KELCH repeat 252..298 CDD:276965 12/46 (26%)
Kelch_3 261..310 CDD:290151 12/49 (24%)
Kelch_5 299..>329 CDD:290565 10/36 (28%)
KELCH repeat 302..355 CDD:276965 15/66 (23%)
Kelch_1 358..400 CDD:279660 13/55 (24%)
KELCH repeat 359..407 CDD:276965 13/61 (21%)
KELCH repeat 410..455 CDD:276965 10/59 (17%)
Kelch_1 410..452 CDD:279660 9/56 (16%)
Kelch_1 466..509 CDD:279660 12/72 (17%)
KELCH repeat 467..509 CDD:276965 12/71 (17%)
BTB 564..704 CDD:279045
BTB 575..707 CDD:197585
SPOP_C_like 707..766 CDD:269810
BTB 798..898 CDD:279045
BTB 802..902 CDD:197585
SPOP_C_like 902..960 CDD:269810
hcf-1NP_501279.1 Kelch_1 43..81 CDD:279660 11/38 (29%)
KELCH repeat 44..89 CDD:276965 12/46 (26%)
KELCH repeat 93..145 CDD:276965 15/67 (22%)
Kelch_3 102..155 CDD:290151 18/68 (26%)
Kelch_5 145..193 CDD:290565 11/48 (23%)
KELCH repeat 212..267 CDD:276965 13/60 (22%)
Kelch_3 227..277 CDD:290151 15/55 (27%)
KELCH repeat 269..334 CDD:276965 12/78 (15%)
Kelch_5 334..376 CDD:290565 17/48 (35%)
PPP4R2 <488..546 CDD:286293
FN3 <606..635 CDD:238020
FN3 641..739 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.