DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and Y50D7A.1

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_497184.3 Gene:Y50D7A.1 WormBaseID:WBGene00021751 Length:564 Species:Caenorhabditis elegans

Alignment Length:338 Identity:62/339 (18%)
Similarity:122/339 (36%) Gaps:97/339 (29%)


  Fly   118 HESFFLRSSFKSSK-------------RNKARKSASTAGCLDAQHIRANLRMSMSSSMRSSRGNG 169
            |..|:....|:..:             |.::.:::|::|.||..   |:..:.....:.|.|.| 
 Worm    78 HSEFYTHPKFQFERCSPDDEEEEVVAGRIRSPRTSSSSGQLDKV---ADEFVVKDVEIMSERQN- 138

  Fly   170 GGGAASSSHPPGSSCSSGPGGSGCSMAYDAASNASSGSGSG-SGKATSPGSYSCNALNVDFTSYT 233
                                  .|:..::...:.....|.. .|...:||:...:...:|    |
 Worm   139 ----------------------ACATYFEPTRSLYLFGGEAIDGDEHTPGAVFNDLWRLD----T 177

  Fly   234 ATHQWTRMLECAEFVGAKRSKHTVVAYKDAMFVFGGDNGK------NMLNDLIRFGVKDKSWGRA 292
            ||.:|:|::..:....:.....::|.:...:.:|||::.:      |:..:|..|.....:|...
 Worm   178 ATLKWSRVIISSAPYPSAMCYASLVTWGTQLILFGGNDNRRRCPFANVPPELHYFDTSTSTWRYV 242

  Fly   293 CATGTPPAPRYHHSAVVAGSSMFIFGGYT---GDIHSNSNLTNKN----DLFEYKFQSAMWVEWK 350
            .|||..|: ...|||||:|..||::||:.   .::|..:.|..:.    |:....:::....:|.
 Worm   243 PATGNSPS-SIGHSAVVSGDYMFVYGGWPFIHNELHLETPLRVERLQILDIRHETWKTVQLEKWN 306

  Fly   351 FSGRQPVPR------------------------SAHGAAVYDNKMWIYAGYDGNARLNDMWTLNL 391
            .:...|.||                        ..:|::|       ...||....|||.|    
 Worm   307 PADPAPFPRFHTRKTKLILIRDGLLLITGELIPQDYGSSV-------LLQYDVTNPLNDTW---- 360

  Fly   392 TGENQWEEVDQLG 404
                :|:.:..:|
 Worm   361 ----RWKSIPTIG 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 41/206 (20%)
KELCH repeat 252..298 CDD:276965 11/52 (21%)
Kelch_3 261..310 CDD:290151 16/55 (29%)
Kelch_5 299..>329 CDD:290565 12/33 (36%)
KELCH repeat 302..355 CDD:276965 14/60 (23%)
Kelch_1 358..400 CDD:279660 11/66 (17%)
KELCH repeat 359..407 CDD:276965 11/71 (15%)
KELCH repeat 410..455 CDD:276965
Kelch_1 410..452 CDD:279660
Kelch_1 466..509 CDD:279660
KELCH repeat 467..509 CDD:276965
BTB 564..704 CDD:279045
BTB 575..707 CDD:197585
SPOP_C_like 707..766 CDD:269810
BTB 798..898 CDD:279045
BTB 802..902 CDD:197585
SPOP_C_like 902..960 CDD:269810
Y50D7A.1NP_497184.3 Kelch_4 136..192 CDD:290154 13/83 (16%)
PLN02153 150..>369 CDD:177814 48/239 (20%)
KELCH repeat 196..247 CDD:276965 11/51 (22%)
KELCH repeat 250..300 CDD:276965 13/51 (25%)
Kelch_2 253..301 CDD:284956 13/48 (27%)
KELCH repeat 315..361 CDD:276965 9/61 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.