DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and KLHDC3

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:XP_024302088.1 Gene:KLHDC3 HGNCID:20704 Length:395 Species:Homo sapiens

Alignment Length:232 Identity:64/233 (27%)
Similarity:104/233 (45%) Gaps:29/233 (12%)


  Fly   212 GKATSPGSYSCNALNVDFTSYTATHQWTRMLECAEFVGAKRSKHTVVAYKDAMFVFGG--DNGKN 274
            |:..:.|  :||.|   :.....||:|..........|| |..|:.......|::|||  .....
Human   107 GRNDTEG--ACNVL---YAFDVNTHKWFTPRVSGTVPGA-RDGHSACVLGKIMYIFGGYEQQADC 165

  Fly   275 MLNDLIRFGVKDKSWGRACATGTPPAPRYHHSAVVAGSSMFIFGGYT---GDIHSNSNL-TNKND 335
            ..||:.:......:|...|..|:|...|..|||.:.||.|::|||..   |..|||:.: .|:..
Human   166 FSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIR 230

  Fly   336 LFEYKFQSAMWVEWKFSGRQPVPRSAHGAAVYDNKMWIYAGYDGNARLN----DMWTLNLTGENQ 396
            :|:.:.::  |::...:...|..|.:|.|..|:.:::|:.||  |||||    |:|..|..... 
Human   231 VFDTRTEA--WLDCPPTPVLPEGRRSHSAFGYNGELYIFGGY--NARLNRHFHDLWKFNPVSFT- 290

  Fly   397 WEEVDQLGDRP----PTCCNFPVAVARDAMYVFSGQS 429
            |::::..|..|    ..||    .:..|.:.:|.|.|
Human   291 WKKIEPKGKGPCPRRRQCC----CIVGDKIVLFGGTS 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 57/208 (27%)
KELCH repeat 252..298 CDD:276965 11/48 (23%)
Kelch_3 261..310 CDD:290151 14/51 (27%)
Kelch_5 299..>329 CDD:290565 14/33 (42%)
KELCH repeat 302..355 CDD:276965 17/57 (30%)
Kelch_1 358..400 CDD:279660 16/46 (35%)
KELCH repeat 359..407 CDD:276965 17/52 (33%)
KELCH repeat 410..455 CDD:276965 6/21 (29%)
Kelch_1 410..452 CDD:279660 6/21 (29%)
Kelch_1 466..509 CDD:279660
KELCH repeat 467..509 CDD:276965
BTB 564..704 CDD:279045
BTB 575..707 CDD:197585
SPOP_C_like 707..766 CDD:269810
BTB 798..898 CDD:279045
BTB 802..902 CDD:197585
SPOP_C_like 902..960 CDD:269810
KLHDC3XP_024302088.1 PLN02193 63..>331 CDD:330882 64/233 (27%)
KELCH repeat 90..135 CDD:276965 8/33 (24%)
KELCH repeat 141..186 CDD:276965 10/45 (22%)
KELCH repeat 193..249 CDD:276965 17/58 (29%)
KELCH repeat 252..296 CDD:276965 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.