DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lztr1 and lztr1

Sequence 1:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_001121508.1 Gene:lztr1 XenbaseID:XB-GENE-998506 Length:778 Species:Xenopus tropicalis

Alignment Length:754 Identity:419/755 (55%)
Similarity:552/755 (73%) Gaps:14/755 (2%)


  Fly   220 YSCN----ALNVDFTSYTATHQWTRMLECAEFVGAKRSKHTVVAYKDAMFVFGGDNGKNMLNDLI 280
            :||:    .|.::|..:.:.|:|.|:|.|.|||||:||||||||||||::||||||||||||||:
 Frog    15 HSCSDSVEYLTLNFGPFESVHRWRRLLPCDEFVGARRSKHTVVAYKDAIYVFGGDNGKNMLNDLL 79

  Fly   281 RFGVKDKSWGRACATGTPPAPRYHHSAVVAGSSMFIFGGYTGDIHSNSNLTNKNDLFEYKFQSAM 345
            ||.|||.||.||..||:||||||||||||.|||||:||||||||:|||||.||||||||||.:.:
 Frog    80 RFDVKDCSWCRAFTTGSPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGL 144

  Fly   346 WVEWKFSGRQPVPRSAHGAAVYDNKMWIYAGYDGNARLNDMWTLNLTGENQ--WEEVDQLGDRPP 408
            |.|||..||.||.||||||.||.:|:||:||||||||||||||:.|...:.  |||::|.|:.||
 Frog   145 WTEWKIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQDRDLTCWEEIEQSGEIPP 209

  Fly   409 TCCNFPVAVARDAMYVFSGQSGLQITNSLFEFHFKTRTWRRISNEPVLRGATSAPPSRRYGHTMV 473
            :||||||||.||.|:|||||||.:|||:||:|.|..:.|.||..|.:||| :..||.||||||||
 Frog   210 SCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFSEKVWTRIPTEHLLRG-SPPPPQRRYGHTMV 273

  Fly   474 HHDRFLYVFGGSADSTLPNDLHCYDLDSQVWSVIQPEQNSDVPSGRVFHASAVICDAMYIFGGTV 538
            ..||.||||||:||:||||:|||||:|||.|.|||...:|::||||:|||:|||.||||||||||
 Frog   274 AFDRHLYVFGGAADNTLPNELHCYDVDSQSWEVIQASPDSELPSGRLFHAAAVIADAMYIFGGTV 338

  Fly   539 DNSVRRGDTYRFQFSSYPKCTLRDDFGKFFQDKQFCDIQFIVGAEEIRILAHIAFVAARSKYLRN 603
            ||:||.|:.||||||.||||||.:|:|:.|:::||||::||:|.:|.|:..|.|.|.||.|:||.
 Frog   339 DNNVRSGEMYRFQFSCYPKCTLHEDYGRLFENQQFCDVEFILGEKEERVRGHTAIVTARCKWLRK 403

  Fly   604 KILAAREARQQQM-----EKVYGVGQVDALALNAGAGGDRGPMLEVRLANASPEAFEIILNYIYT 663
            ||:.|||.::|::     :::....|....|.:........|||||.:.:|....||:::.::||
 Frog   404 KIMQARERQKQKLKQEPEDEMQNSQQKTESACSQVKLSRSQPMLEVIIRDAEARPFELLMQFLYT 468

  Fly   664 DRIDLKDTYSKNIIILITDIYQLAGLFTMPRLAHGCIQYLDYKINKLNVLEALYNADKSNIKIIK 728
            |:|..........::||.|:|:||..|.:.||...|:||::..::..|||....||:|..:..:|
 Frog   469 DKIKYPRKGHVEDVLLIMDVYKLALHFKLSRLEQLCVQYIEASVDLQNVLGVCENANKLQLDELK 533

  Fly   729 DHCMQFIIKEENFTDVVMSSEFSDLDKPLLVEIIRKRLYPSKLVIDTSYEGNIGTTLEIDLCAFL 793
            :||:.|::||.:|..|:|..||..|...|:|||:|::..| .|.|.:....:|||:|..|:.|:|
 Frog   534 EHCLNFVVKESHFNQVIMMKEFEHLSSSLIVEIVRRKQQP-PLRIHSDQPVDIGTSLVQDMKAYL 597

  Fly   794 ESTGKDFCDISLVLEDHVIPAHKSVLSSRCTYFQGMFRSFMPPDNTVNIQIGEISPSLEAFHSLL 858
            |..|.|||||:|:|:.|..|||:::|::|.:||:.|||||||.|..|||.|||:.||.:||.|||
 Frog   598 EGAGNDFCDITLLLDGHPRPAHQAILAARSSYFEAMFRSFMPEDGQVNISIGEMVPSKQAFESLL 662

  Fly   859 RYIYYGETKMPPQDALYLFQAPCFYGLANNRLHAFCKYSLEHNITFENVLQTLEASDITKIYDIK 923
            |||||||..|||:|:||||.||.:||..:|||.|:|:.:||.|:|.|||||.|||:|.|:..|:|
 Frog   663 RYIYYGEVNMPPEDSLYLFSAPYYYGFFSNRLQAYCRQNLEMNVTVENVLQILEAADKTQAVDMK 727

  Fly   924 EYALKLIVKDFAKVARLPKIAGLSRELLLEIIRAVADSH 962
            ::.|.:||..|.|||:||.:..||:.||:.||.::| ||
 Frog   728 KHCLHIIVHQFTKVAKLPNLRLLSQPLLINIIESLA-SH 765

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 227/319 (71%)
KELCH repeat 252..298 CDD:276965 37/46 (80%)
Kelch_3 261..310 CDD:290151 40/49 (82%)
Kelch_5 299..>329 CDD:290565 27/30 (90%)
KELCH repeat 302..355 CDD:276965 42/53 (79%)
Kelch_1 358..400 CDD:279660 29/44 (66%)
KELCH repeat 359..407 CDD:276965 31/50 (62%)
KELCH repeat 410..455 CDD:276965 29/45 (64%)
Kelch_1 410..452 CDD:279660 28/42 (67%)
Kelch_1 466..509 CDD:279660 34/43 (79%)
KELCH repeat 467..509 CDD:276965 33/42 (79%)
BTB 564..704 CDD:279045 51/145 (35%)
BTB 575..707 CDD:197585 46/137 (34%)
SPOP_C_like 707..766 CDD:269810 23/59 (39%)
BTB 798..898 CDD:279045 60/100 (60%)
BTB 802..902 CDD:197585 60/100 (60%)
SPOP_C_like 902..960 CDD:269810 29/58 (50%)
lztr1NP_001121508.1 PLN02153 51..348 CDD:177814 212/298 (71%)
KELCH repeat 51..97 CDD:276965 37/46 (80%)
Kelch_3 60..109 CDD:290151 40/49 (82%)
KELCH repeat 101..155 CDD:276965 42/54 (78%)
Kelch_3 110..166 CDD:290151 43/56 (77%)
Kelch_5 155..186 CDD:290565 25/31 (81%)
Kelch_3 220..275 CDD:290151 34/56 (61%)
KELCH repeat 267..311 CDD:276965 33/44 (75%)
Kelch_3 279..327 CDD:290151 34/48 (71%)
BTB 364..508 CDD:295341 51/144 (35%)
SPOP_C_like 512..572 CDD:269810 23/60 (38%)
BTB 603..687 CDD:279045 53/84 (63%)
BTB 606..703 CDD:197585 58/97 (60%)
SPOP_C_like 706..764 CDD:269810 29/59 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C296311617
eggNOG 1 0.900 E1_2CMFB
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H4925
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1263405at2759
OrthoFinder 1 1.000 FOG0007486
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.