DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13359 and AT3G53040

DIOPT Version :9

Sequence 1:NP_569861.1 Gene:CG13359 / 31028 FlyBaseID:FBgn0025616 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_190872.1 Gene:AT3G53040 / 824470 AraportID:AT3G53040 Length:479 Species:Arabidopsis thaliana


Alignment Length:396 Identity:95/396 - (23%)
Similarity:145/396 - (36%) Gaps:67/396 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 VTWQSHSIIDCLALRKVRAEMNLADQKAAKNLVDRVEVHHKTLQTEEAERRKLIIDKANSARNLT 195
            |..:||...:     ..|...::|.:|||.......||...|.| :..|......|||..|::.|
plant    69 VIGKSHDTAE-----STREGADIASEKAAGMRDTTGEVRDSTAQ-KTKETADYTADKAREAKDKT 127

  Fly   196 IDKANSARILAIDKATSARKLTIDNSTSAGTLTIDKATNARKLTIDKGTSARKLTIDKA-----T 255
            .||.......|.:||..|:..|.|.:......|.:||..|:..|.||....:..|.:||     |
plant   128 ADKTKETADYAAEKAREAKDRTADKTKETAEYTAEKAREAKDKTADKLGEYKDYTAEKAKEAKDT 192

  Fly   256 SARKL------TIDKATSARKMTIDKAKSTRNLTIDNATSARKLTIEK-------ATSARKMTID 307
            :|.||      |:|||..|:..|.:|||.|...|.|.|...:..|.||       .....|.|.|
plant   193 TAEKLGEYKDYTVDKAKEAKDKTAEKAKETAEYTSDKARETKDKTAEKVGEYKDYTAEKAKETAD 257

  Fly   308 KAKSTRNLTIDNATSARKLTIEKATSARRFSRPK------------RYVSGYISKRKSIGKTESL 360
            ||:..::.|.:.....|..|.||||..:.....|            :...|::|     ||||..
plant   258 KAREAKDKTAEKVGEYRDYTAEKATETKDAGVSKIGELKDSAVDTAKRAMGFLS-----GKTEET 317

  Fly   361 SRGAYIPDPELNRAIAKYGVSASQPFKRQHCLVLEKHPDRTQIPNSRTNTSGCKSD--------- 416
            .:.|..........:.:.|..|.:..:.......:...|.::.....|.::..|:.         
plant   318 KQKAVETKDTAKEKMDEAGEEARRKMEEMRLEGKKLDEDASRKTQQSTESAADKAHETKDSVAQR 382

  Fly   417 ------------GSSTPIWRSARTGADQNTQAESSDSFNSSNSFESSSLASDSQENHELSTAAGL 469
                        |:.|...:|..|||...:..|:..|.:...|...:.:|.|.::     |..|.
plant   383 GEEGKGSIMGALGNMTGAIKSKLTGATTPSDEETRASAHGDESTGKTVVAVDVKD-----TRPGY 442

  Fly   470 TAAFMR 475
            .|..::
plant   443 VATVLK 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13359NP_569861.1 None
AT3G53040NP_190872.1 Neuromodulin_N <106..>385 CDD:331332 70/284 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.