DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13359 and AT2G18340

DIOPT Version :9

Sequence 1:NP_569861.1 Gene:CG13359 / 31028 FlyBaseID:FBgn0025616 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_179425.1 Gene:AT2G18340 / 816349 AraportID:AT2G18340 Length:456 Species:Arabidopsis thaliana

Alignment Length:249 Identity:63/249 - (25%)
Similarity:105/249 - (42%) Gaps:41/249 - (16%)


  Fly   145 RKVRAEMNLADQKAAKNLVDRVEV----------HHKTLQTEEAERRK-LIIDKANSARNLTIDK 198
            :|.:.|...|.|.|.....|:...          :.|.....:||..| ...|||..|:|:..:.
plant    63 QKSKDEARKAAQAAENYAYDKANYVKDSAYDNAGYAKDFAENKAEYAKDFAYDKAGDAKNMAYEN 127

  Fly   199 ANSARILAIDKATSARKLTIDNSTSAGTLTIDKATNARKL-----------TIDKGTSARKLTID 252
            |..|:..|.|||..|:.:..:.:..|.....|||.||:.:           ..|||..|:.:..|
plant   128 AGYAKDFAYDKAGDAKDMAYEKAGHAKDFAYDKAGNAKDMAYETAGYAKDFAYDKGGYAKDVAYD 192

  Fly   253 KATSARKLTIDKATSARKMTIDKAKSTRNLT------------------IDNATSARKLTIEKAT 299
            ||.:|:.:..:||.:|:.|..:||:..::.|                  .|.|..|:.:..|||.
plant   193 KAGNAKDMAYEKAGNAKDMAYEKAEHIKDFTYDKVGSAYGSAQSMMDSGYDKAGDAKDMAYEKAG 257

  Fly   300 SARKMTIDKAKSTRNLTIDNATSARKLTIEKATSARRFSRPKRYVSGYISKRKS 353
            ..:.|..|||...:::..:.|..|:.:..:||.:|:..:..| ..|.|.|.:|:
plant   258 IVKDMAYDKAGDAKDVAYEKAGIAKDMAYDKAGNAKDMAYDK-VGSAYGSAQKA 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13359NP_569861.1 None
AT2G18340NP_179425.1 LEA_4 77..120 CDD:111833 8/42 (19%)
LEA_4 132..175 CDD:111833 11/42 (26%)
LEA_4 176..218 CDD:111833 14/41 (34%)
LEA_4 260..303 CDD:111833 10/43 (23%)
LEA_4 311..353 CDD:111833 63/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3173
orthoMCL 1 0.900 - - OOG6_110249
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.