| Sequence 1: | NP_569861.1 | Gene: | CG13359 / 31028 | FlyBaseID: | FBgn0025616 | Length: | 493 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_179425.1 | Gene: | AT2G18340 / 816349 | AraportID: | AT2G18340 | Length: | 456 | Species: | Arabidopsis thaliana |
| Alignment Length: | 249 | Identity: | 63/249 - (25%) |
|---|---|---|---|
| Similarity: | 105/249 - (42%) | Gaps: | 41/249 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 145 RKVRAEMNLADQKAAKNLVDRVEV----------HHKTLQTEEAERRK-LIIDKANSARNLTIDK 198
Fly 199 ANSARILAIDKATSARKLTIDNSTSAGTLTIDKATNARKL-----------TIDKGTSARKLTID 252
Fly 253 KATSARKLTIDKATSARKMTIDKAKSTRNLT------------------IDNATSARKLTIEKAT 299
Fly 300 SARKMTIDKAKSTRNLTIDNATSARKLTIEKATSARRFSRPKRYVSGYISKRKS 353 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13359 | NP_569861.1 | None | |||
| AT2G18340 | NP_179425.1 | LEA_4 | 77..120 | CDD:111833 | 8/42 (19%) |
| LEA_4 | 132..175 | CDD:111833 | 11/42 (26%) | ||
| LEA_4 | 176..218 | CDD:111833 | 14/41 (34%) | ||
| LEA_4 | 260..303 | CDD:111833 | 10/43 (23%) | ||
| LEA_4 | 311..353 | CDD:111833 | 63/249 (25%) | ||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4744 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 1 | 1.000 | - | - | otm3173 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_110249 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.710 | |||||