DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13359 and Plin4

DIOPT Version :8

Sequence 1:NP_569861.1 Gene:CG13359 / 31028 FlyBaseID:FBgn0025616 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_011244848.1 Gene:Plin4 / 57435 MGIID:1929709 Length:1649 Species:Mus musculus

Alignment Length:367 Identity:81/368 (22%)
Similarity:130/368 (35%) Gaps:84/368 (23%)


  Fly   196 IDKANSARILAIDKATSARKLTIDNSTSAGTLTIDKATNARKLTIDKGTSARKLTIDKATSARKL 260
            |:.|..|....:|...|....|.|..|:..|..|:.|..|.:..:|...|....|.|..|:....
Mouse  1121 INVAKGATQGGLDTTKSVLMGTKDTVTTGLTGAINVAKGAAQGGLDTTKSVLLGTKDTVTTGLTG 1185

  Fly   261 TIDKATSARKMTIDKAKS----TRNLTIDNATSARKLTIEK---------ATSARKMTIDKAKST 312
            ..:.|....:|.:|.:|:    |::.....||.|  :|:.|         :.:|...|:|.||.|
Mouse  1186 AANVAKETVQMGLDTSKNILMDTKDSICAGATGA--ITVVKGAAQGGLDTSNAALTGTMDTAKGT 1248

  Fly   313 RNLTIDNA---------------TSARKLT--IEKATSARRFSRPKRYVSGYISKRKSIGKTESL 360
            ...::|.:               |||..:.  |.|.|...|.::     |..::...::. |.::
Mouse  1249 VQTSLDTSKHMLIGMKDTVCAGVTSAMNMAKGIHKNTDTTRDTQ-----SSVLAHSGNVA-TNAI 1307

  Fly   361 SRGAY-IP------------DPELNRAIAKYGV----------------SASQPFKRQHCLVLEK 396
            ..|.: :|            :|.:.|| ..:||                |.|..:...|  |.|.
Mouse  1308 HTGVHTVPSSLSGSHSIICHEPSIYRA-TNHGVGQAILTSTESLCCETSSFSDKYGLGH--VTEP 1369

  Fly   397 HPDRTQIPNSRTNTSGCKSDGSSTPIWRSARTG--ADQNTQAESSDSFNSSNSFESSSLASDSQE 459
            ..| |:...|...:|.|.:..|.....:.|.||  |..:......|.|....:.|.:.||.....
Mouse  1370 RAD-TKTLVSGMASSACAATRSVEECGQLAATGFAALPDELKGLGDIFQPMTTEEQAQLAVSESG 1433

  Fly   460 NHELSTAAG--------LTAAFMRR---HMLFHLLARRFRRR 490
            ...||...|        |..:|.:|   |.|.|:...:|:.|
Mouse  1434 PRVLSADRGSYYIRLGDLAPSFRQRAFEHALSHIQHNQFQAR 1475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13359NP_569861.1 None
Plin4XP_011244848.1 Perilipin <177..>223 CDD:281086
Perilipin <210..>288 CDD:281086
Perilipin <309..>420 CDD:281086
Perilipin <408..>486 CDD:281086
Perilipin <474..>552 CDD:281086
Perilipin <540..>618 CDD:281086
Perilipin <605..>651 CDD:281086
Perilipin <672..>783 CDD:281086
Perilipin <812..>882 CDD:281086
Perilipin <870..>948 CDD:281086
Perilipin <935..>981 CDD:281086
Perilipin <1002..>1080 CDD:281086
Perilipin <1068..>1146 CDD:281086 7/25 (28%)
Perilipin <1373..1631 CDD:281086 25/104 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.