DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16989 and SYF1

DIOPT Version :8

Sequence 1:NP_001284761.1 Gene:CG16989 / 31026 FlyBaseID:FBgn0025621 Length:940 Species:Drosophila melanogaster
Sequence 2:NP_010704.1 Gene:SYF1 / 852025 SGDID:S000002824 Length:859 Species:Saccharomyces cerevisiae

Alignment Length:229 Identity:52/230 (23%)
Similarity:82/230 (36%) Gaps:72/230 (31%)


  Fly   231 VRISALHLLSTLTNQLPRRSFYGYWHVLFPDGDAGGTPHLLLLGLKDTNFRCRA--LALQVGAQL 293
            :.::..|.||:|:.:          |:.|....|       |..|......|:.  :|..|..:.
Yeast   628 LEVATSHQLSSLSPE----------HIRFLFEKA-------LKNLCSNGIDCKTIFIAYSVFEER 675

  Fly   294 LYG--SKA--FLSQACSLGPSNFTPFAVSLAS---SVLTAYRILIAILEREYTPPVLTQCL-KCL 350
            :.|  ||:  .|.:...:|       .||:::   |.|..:|:.|:..|....|.|..:.. :|:
Yeast   676 ISGLISKSIEILRRGAVIG-------TVSVSTHLESRLQLWRMCISKAESTLGPSVTRELYQECI 733

  Fly   351 AVLVQATPFHQLEMGFVYEFVGHVKKLIKSSDPPVAVSALLVMEMLVGTSKLTPEI-ASSIGLAP 414
            .:|..:.         ..|||      ||.||          .|..:|.:....|| |....|.|
Yeast   734 QILPNSK---------AVEFV------IKFSD----------FESSIGETIRAREILAYGAKLLP 773

  Fly   415 SQRNLQMEHASTAETYQELCDSDAEMELEEGDEQ 448
            ..||            .||.||....||:.||::
Yeast   774 PSRN------------TELWDSFEIFELKHGDKE 795

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16989NP_001284761.1 DUF4042 230..406 CDD:289992 38/185 (21%)
HEAT repeat 512..543 CDD:293787
HEAT_2 606..723 CDD:290374
HEAT repeat 607..640 CDD:293787
HEAT repeat 650..680 CDD:293787
ARM 692..810 CDD:237987
HEAT repeat 695..724 CDD:293787
HEAT repeat 740..770 CDD:293787
HEAT repeat 784..812 CDD:293787
HEAT repeat 823..845 CDD:293787
SYF1NP_010704.1 Suf 16..>102 CDD:331814
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.