DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16989 and HEATR6

DIOPT Version :8

Sequence 1:NP_001284761.1 Gene:CG16989 / 31026 FlyBaseID:FBgn0025621 Length:940 Species:Drosophila melanogaster
Sequence 2:NP_071353.4 Gene:HEATR6 / 63897 HGNCID:24076 Length:1181 Species:Homo sapiens

Alignment Length:977 Identity:278/977 - (28%)
Similarity:439/977 - (44%) Gaps:157/977 - (16%)


  Fly    15 GFWPRLSALTHAKDMDVALLLLQCQDRVLAELEESPEVAEHNQGLVNSLINMHFEGRWLVAKEQL 79
            |...:||.|..: |.:|....:.|...:...:...|.:.|..|       |:.|:....:.  |.
Human   166 GLLMKLSDLAQS-DPEVRRAAVHCMANLCLSVPGQPYLEEPYQ-------NVCFQAFLTIL--QS 220

  Fly    80 P-----------LLLAQSLQLIQKLVT--RQPDYAAQRVPELMGLVQCYLQYGAEGETHLKPRKL 131
            |           :||..:|:.||.|:.  |........:..|:.:::.::.:|..|.....|..|
Human   221 PKSSDMDDITFCMLLQNALKGIQSLLNGGRMKLTQTDELGALLAVLKKFMFHGLPGLNIEMPTVL 285

  Fly   132 PPAQQSAAYGQEKEEEDQLLAQMSRPCGRKNKVRKMRSLAKQRNQAVNEHHEPNPR-ERLVLMGN 195
            .|.......|:...:..|..:..|||  ..||.:|.:...|:..|...|..|.:.. |...:.|.
Human   286 YPTPLPQYDGRTPIKPQQSESSASRP--TLNKKKKSKVKPKKIQQGEEEEKESSGEIEAAPVTGT 348

  Fly   196 QDYGCLTGDS------GENGLPSD-----------------------------SDQQQTENKHHR 225
            .......|::      |...||.|                             ||.:.......|
Human   349 GRVNLHEGNTWCPSSLGVQSLPLDGSGAAEKDGVSSSFSSSSWKRVSSSESDFSDAEGGMQSKMR 413

  Fly   226 HQEAKVRISALHLLSTLTNQLPRRSFYGYWHVLFPDGDAGGTPH---LLLLGLKDTNFRCRALAL 287
            ..:||||..||....:....:.::..||||....||....|:|.   |:.|.|||.:.:.||.||
Human   414 SYQAKVRQGALVCFLSTIKSIEKKVLYGYWSAFIPDTPELGSPQSVSLMTLTLKDPSPKTRACAL 478

  Fly   288 QVGAQLLYGSKAFLSQACSLGPSN--FTPFAVSLASSVLTAYRILIAILEREYTPPVLTQCLKCL 350
            ||.:.:|.|||.|||.|.......  ||||:|.:|.|:...:|.|:..|..|.:...:||.:|||
Human   479 QVLSAILEGSKQFLSVAEDTSDHRRAFTPFSVMIACSIRELHRCLLLALVAESSSQTVTQIIKCL 543

  Fly   351 AVLVQATPFHQLEMGFVYEFVGHVKKLIKSSDPPVAVSALLVMEMLVGTSKLTPEI------ASS 409
            |.||...|:.:|::..:.:....:|..|:..|..|.||:|.::..:|.|....||:      ..|
Human   544 ANLVSNAPYDRLKLSLLTKVWNQIKPYIRHKDVNVRVSSLTLLGAIVSTHAPLPEVQLLLQQPCS 608

  Fly   410 IGLAPSQRNLQMEHASTAETYQELCDSDAEMELEEGDEQQQPSQNNVVNPVHTVSPTIPRNSWLL 474
            .||..|  |....|.|..:.:::   :.|...|||         .:|.:|..:..|     .||:
Human   609 SGLGNS--NSATPHLSPPDWWKK---APAGPSLEE---------TSVSSPKGSSEP-----CWLI 654

  Fly   475 RQVLRCLEGMRI--------------------PSAVRLECFQVLQAMAT-HIGLLRGHQVRLSRV 518
            |   .|:..:.:                    ||.:|||..|||..:|. :..:.:.:.:.|..|
Human   655 R---LCISIVVLPKEDSCSGSDAGSAAGSTYEPSPMRLEALQVLTLLARGYFSMTQAYLMELGEV 716

  Fly   519 I--SAGLTDPATDVKLYAARCLDSVGYQL-GRLLPE----PAERE---LQMSFWLTLL--PATYE 571
            |  ..|..||:  ::|:.|:.|:.:|..| .:..|:    |.:|.   |.:.||..:|  |....
Human   717 ICKCMGEADPS--IQLHGAKLLEELGTGLIQQYKPDSTAAPDQRAPVFLVVMFWTMMLNGPLPRA 779

  Fly   572 AYDSAGFSLKCALCDALSNMGAISFERLPDGQRTALLAFLSGCASDDHEETLVRVAALRAMAVYV 636
            ..:|...:|:.:.|||||::...:|..||:.::...:..|.|.  :|.:..||:.|..||:.|||
Human   780 LQNSEHPTLQASACDALSSILPEAFSNLPNDRQMLCITVLLGL--NDSKNRLVKAATSRALGVYV 842

  Fly   637 LHPSLRTDLGFVENAAELTLRILGDSQLLARIKAAWALGNISDALVAGI----PNQTERISAELL 697
            |.|.||.|:.||.:||...|..|.|..|..|.||||:|||::|.|:..:    |:..|..|..||
Human   843 LFPCLRQDVIFVADAANAILMSLEDKSLNVRAKAAWSLGNLTDTLIVNMETPDPSFQEEFSGLLL 907

  Fly   698 ERLIQAATKSCADNDKVRANAVRALGNLLQILQ---VQPLGNGELMQVAMSKLLDCVTLPGNAKV 759
            .:::::|.::..|.|||::||||||||||..||   ::.....|:::.::..|:..|......||
Human   908 LKMLRSAIEASKDKDKVKSNAVRALGNLLHFLQPSHIEKPTFAEIIEESIQALISTVLTEAAMKV 972

  Fly   760 KWNACYVIGNLVKHRAF---------FANNRLAGILFPTLCQLVVQHANFKVRTNAAGVLLQVKQ 815
            :|||||.:||:.|:.|.         .|.|.|..::  |.|:      |||||..:|..|....:
Human   973 RWNACYAMGNVFKNPALPLGTAPWTSQAYNALTSVV--TSCK------NFKVRIRSAAALSVPGK 1029

  Fly   816 REDFSA--HFPLLWRSLLDALVRSNVLESFEEYNHRDALQQQLCLAIAHLLLLARSSDLPMMRES 878
            ||.:.:  .:..:|.:|:.||.:|.....|.|:.:..:|:.|:|.|:.|||.||.:||||.|:|:
Human  1030 REQYGSVDQYARIWNALVTALQKSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKET 1094

  Fly   879 LE 880
            ||
Human  1095 LE 1096

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16989NP_001284761.1 DUF4042 230..406 CDD:289992 63/180 (35%)
HEAT repeat 512..543 CDD:293787 9/32 (28%)
HEAT_2 606..723 CDD:290374 49/120 (41%)
HEAT repeat 607..640 CDD:293787 12/32 (38%)
HEAT repeat 650..680 CDD:293787 14/29 (48%)
ARM 692..810 CDD:237987 45/129 (35%)
HEAT repeat 695..724 CDD:293787 13/28 (46%)
HEAT repeat 740..770 CDD:293787 10/29 (34%)
HEAT repeat 784..812 CDD:293787 9/27 (33%)
HEAT repeat 823..845 CDD:293787 6/21 (29%)
HEATR6NP_071353.4 HEAT 1 159..198 7/32 (22%)
DUF4042 418..599 CDD:289992 63/180 (35%)
HEAT 2 452..490 16/37 (43%)
HEAT 3 515..552 13/36 (36%)
HEAT 4 558..595 9/36 (25%)
HEAT repeat 810..843 CDD:293787 10/34 (29%)
HEAT_EZ 830..883 CDD:290247 27/52 (52%)
HEAT repeat 857..886 CDD:293787 14/28 (50%)
HEAT repeat 909..934 CDD:293787 11/24 (46%)
HEAT repeat 957..983 CDD:293787 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C338208159
eggNOG 1 0.900 E1_KOG2047
Hieranoid 1 1.000
Homologene 1 1.000 H11116
Inparanoid 1 1.050 291 1.000 Inparanoid score I2758
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D106835at2759
OrthoFinder 1 1.000 FOG0007690
OrthoInspector 1 1.000 T1075557
orthoMCL 1 0.900 OOG5_133276
Panther 1 1.100 LDO PTHR13366
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5863
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.