DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16989 and heatr6

DIOPT Version :8

Sequence 1:NP_001284761.1 Gene:CG16989 / 31026 FlyBaseID:FBgn0025621 Length:940 Species:Drosophila melanogaster
Sequence 2:NP_001107785.1 Gene:heatr6 / 567838 ZFINID:ZDB-GENE-080204-118 Length:1201 Species:Danio rerio

Alignment Length:871 Identity:263/872 (30%)
Similarity:383/872 (44%) Gaps:122/872 (14%)


  Fly   103 QRVPELMGLVQCYLQYGAEGETHLKPRKLPPA--QQSAAYGQEKEEEDQLLAQMSRPCGRKNKVR 165
            |.:..|:.:::.::.||..|.:...|:.|.||  .|.......|.|..|......:....:.|.|
Zfish   280 QDLGALLAVLKRFMFYGLPGISVEMPQVLYPAPLPQYETIPAVKPEPAQDTPAQKKTAASQQKKR 344

  Fly   166 KMRSLAKQRNQAVNEHHEPNPRERLVLMGNQDYGCLTGDSGENGLPSD----------------- 213
            |.|...|   :...|..:....:.:...|..|....:..|..:.|.|.                 
Zfish   345 KSRGKGK---KGAGEGKQDGEADDVSAAGGGDQSGWSHGSQSSMLTSPSVATPQLYPSWKKCSSD 406

  Fly   214 ---SDQQQTENKHHRHQEAKVRISALHLLSTLTNQLPRRSFYGYWHVLFPDGDA-GGTPHLLLL- 273
               ||.:.......|..:|:||.|:|.....:...:.:|..||||....||... ||.|.|.|| 
Zfish   407 SEFSDPEGGMQSKLRLYQARVRQSSLQCFLAVVKCVEKRILYGYWSSFVPDAPGIGGPPPLTLLT 471

  Fly   274 -GLKDTNFRCRALALQVGAQLLYGSKAFLSQACSLGPSN--FTPFAVSLASSVLTAYRILIAILE 335
             .|||...:.||.:|||.:.||.||:.|||.|...|...  ||||:.:||:|:...:|.|:..|.
Zfish   472 IALKDPLPKVRAGSLQVLSALLEGSRQFLSTAEDTGAPRQAFTPFSATLAASIRELHRGLLLALI 536

  Fly   336 REYTPPVLTQCLKCLAVLVQATPFHQLEMGFVYEFVGHVKKLIKSSDPPVAVSALLVMEMLVGTS 400
            .|.:...|||.|||||.||...|:::|..|.:......::..::..|..|.||:|.:...||.|.
Zfish   537 AESSCQTLTQVLKCLAHLVSNVPYNRLRPGLLSPLWKQIRPYVRHRDVNVRVSSLTLFGALVSTQ 601

  Fly   401 KLTPEI---------ASSIGLA-------------PSQRNLQMEHASTAETYQ------ELCDSD 437
            ...||:         |||:|..             |::|:.:....:.||..:      :||.|.
Zfish   602 APLPEVQLLLQQPGSASSLGSGISTPQESPLSWRQPARRDEEASSPAAAEGPEGPCWLLQLCVSL 666

  Fly   438 AEMELEEGDEQQQPSQNNVVNPVHTVSPTIPRNSWLLRQVLRCLEGMRIPSAVRLECFQVLQAMA 502
            .....||.........:|.. |:.                         ||.||||..|||..:.
Zfish   667 VTQPREEPYSDSDAGGSNGA-PLE-------------------------PSPVRLEALQVLAHLV 705

  Fly   503 T-HIGLLRGHQVRLSRVISAGLTDPATDVKLYAARCLDSVG------YQLGRLLPEPAER---EL 557
            . :..|.:...:.|.::.:..||:....|:|:.|:.|:.:|      |:.....|:.|:|   ..
Zfish   706 KGYFSLAQASLLELGQLSARCLTEQDPSVQLHGAKLLEELGTGIIQQYRADANTPQSAKRVPVNQ 770

  Fly   558 QMSFWLTLL--PATYEAYDSAGFSLKCALCDALSNMGAISFERLPDGQRTALLAFLSGCASDDHE 620
            .:.||..:|  |......:....:|:.:.||.||::...:|.:|||..:...:..|.|....  |
Zfish   771 VVQFWSEVLGGPLISALQNEHHPTLQTSACDTLSSILPQAFSQLPDKTQVLCITILLGLTYS--E 833

  Fly   621 ETLVRVAALRAMAVYVLHPSLRTDLGFVENAAELTLRILGDSQLLARIKAAWALGNISDALV--- 682
            .:||:.||:||:.||:|.|.||.|:.||.:.|...|..|.|.....|.||||:|||::|.|:   
Zfish   834 NSLVKAAAVRALGVYILFPCLREDVMFVADTANAILTALDDRSPNVRAKAAWSLGNLTDTLIVNM 898

  Fly   683 --AGIPNQTERISAELLERLIQAATKSCADNDKVRANAVRALGNLLQILQVQPLGNGELMQ---V 742
              .|:..| |..|..||..::::|||:.||.|:|::||||||||||..||...||.....|   .
Zfish   899 QSVGLEFQ-EDFSDMLLLNMLRSATKASADKDRVKSNAVRALGNLLHFLQPGHLGKPVFEQPLLE 962

  Fly   743 AMSKLLDCVTLPGNAKVKWNACYVIGNLVKHRAFFANNRL-------AGILFPTLCQLVVQHANF 800
            ||..|:|.|......||:|||||.:||.      |.|..|       :...|..|..:|....||
Zfish   963 AMRALIDTVRGDATMKVRWNACYALGNA------FRNQHLPLGSAVWSTEAFSALSCVVTSCKNF 1021

  Fly   801 KVRTNAAGVLLQVKQREDF--SAHFPLLWRSLLDALVRSNVLESFEEYNHRDALQQQLCLAIAHL 863
            |||..:|..|.....||.:  |..|..:||||..||..|...|.|.||.:..:|:.|||.|:.||
Zfish  1022 KVRIKSAAALSVPATRECYGDSQQFSEVWRSLAQALEHSEETEDFLEYRYCASLRSQLCRALLHL 1086

  Fly   864 LLLARSSDLPMMRESLEEDRLEEVQA 889
            |.|.:..|||.:..|:.......:||
Zfish  1087 LSLCQPDDLPALGSSVSGQSRPALQA 1112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16989NP_001284761.1 DUF4042 230..406 CDD:289992 68/181 (38%)
HEAT repeat 512..543 CDD:293787 8/37 (22%)
HEAT_2 606..723 CDD:290374 51/122 (42%)
HEAT repeat 607..640 CDD:293787 13/33 (39%)
HEAT repeat 650..680 CDD:293787 13/30 (43%)
ARM 692..810 CDD:237987 51/128 (40%)
HEAT repeat 695..724 CDD:293787 16/29 (55%)
HEAT repeat 740..770 CDD:293787 15/33 (45%)
HEAT repeat 784..812 CDD:293787 10/28 (36%)
HEAT repeat 823..845 CDD:293787 10/22 (45%)
heatr6NP_001107785.1 HEAT 1 182..221
DUF4042 426..607 CDD:289992 68/181 (38%)
HEAT 2 460..498 18/38 (47%)
HEAT 3 523..560 16/37 (43%)
HEAT 4 566..603 9/37 (24%)
HEAT repeat 783..805 CDD:293787 5/22 (23%)
HEAT repeat 817..850 CDD:293787 11/35 (31%)
HEAT_2 829..940 CDD:290374 49/114 (43%)
HEAT_EZ 837..890 CDD:290247 26/53 (49%)
HEAT repeat 863..893 CDD:293787 13/30 (43%)
ARM 867..989 CDD:237987 54/123 (44%)
HEAT repeat 908..941 CDD:293787 17/33 (52%)
HEAT repeat 957..989 CDD:293787 14/32 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C338211642
eggNOG 1 0.900 E1_KOG2047
Hieranoid 1 1.000
Homologene 1 1.000 H11116
Inparanoid 1 1.050 288 1.000 Inparanoid score I2752
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D106835at2759
OrthoFinder 1 1.000 FOG0007690
OrthoInspector 1 1.000 T1054786
orthoMCL 1 0.900 OOG5_133276
Panther 1 1.100 LDO PTHR13366
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5863
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.