DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16989 and Heatr6

DIOPT Version :8

Sequence 1:NP_001284761.1 Gene:CG16989 / 31026 FlyBaseID:FBgn0025621 Length:940 Species:Drosophila melanogaster
Sequence 2:NP_001073366.1 Gene:Heatr6 / 497972 RGDID:1566204 Length:1252 Species:Rattus norvegicus

Alignment Length:975 Identity:271/976 (28%)
Similarity:435/976 (45%) Gaps:153/976 (16%)


  Fly    14 AGFWPRLSALTHAKDMDVALLLLQCQDRVLAELEESPEVAEHNQGLVNSLINMHFEGRWLVAKE- 77
            :|...:||.:||: |.:|....:.|...:...:...|.:.|..|               ||..: 
  Rat   236 SGLLMKLSDVTHS-DPEVRRAAVHCMANLCLSVPGQPYLEESYQ---------------LVCFQA 284

  Fly    78 -----QLP-----------LLLAQSLQLIQKLVT--RQPDYAAQRVPELMGLVQCYLQYGAEGET 124
                 |.|           :||..:|:.||.|:.  :......:.:..|:.:::..:.:|..|..
  Rat   285 FLTILQSPKSSDMDDITFCMLLQNALKGIQSLLNGGKMRLTQTEHLGALLAVLKKAMFHGLPGLN 349

  Fly   125 HLKPRKLPPAQQSAAYGQEKEEEDQLLAQMSRPCGRKNKVRKMRSLAKQRNQAVNEHHEPNPRER 189
            ...|..|.|.......|:...:..|..:..:||...|.|..|::....|:.:.. |..||.....
  Rat   350 IEMPAVLYPTPLPQYDGRSPVKPQQPESSAARPSANKKKKYKVKPKKTQQGEKA-EEEEPYGEVD 413

  Fly   190 LV--LMGNQDYGCL-----TGDSGENGLP--------------------------SDSDQQQTEN 221
            ..  |..:|...|:     :...|..|||                          |:||....|.
  Rat   414 AAPGLSMDQANTCVESAWCSSPWGSQGLPVDGGRATGREQVSSPFTISSWKRVSSSESDYSDAEG 478

  Fly   222 KHH---RHQEAKVRISALHLLSTLTNQLPRRSFYGYWHVLFPDGDAGGTPH---LLLLGLKDTNF 280
            ...   |..:||||..||....:....:.::..||||....||....|:|.   |:.|.|||.:.
  Rat   479 GMQGKMRSYQAKVRQGALACFLSTIKSIEKKVLYGYWSAFVPDTPELGSPQSVSLMTLTLKDPSP 543

  Fly   281 RCRALALQVGAQLLYGSKAFLSQA--CSLGPSNFTPFAVSLASSVLTAYRILIAILEREYTPPVL 343
            :.||.||||.:.:|.|||.|||.|  .|.....||||:|::|||:...:|.|:..|..|.:...|
  Rat   544 KTRACALQVLSAILEGSKQFLSVAEDTSDHKRAFTPFSVTIASSIRELHRCLLLALVAESSSQTL 608

  Fly   344 TQCLKCLAVLVQATPFHQLEMGFVYEFVGHVKKLIKSSDPPVAVSALLVMEMLVGTSKLTPEI-- 406
            ||.:||||.||...|:::|::..:.:...|:|..|:..|..|.||:|.::..:|.|....||:  
  Rat   609 TQIIKCLANLVSNAPYNRLKLSLLTKVWNHIKPYIRHKDVNVRVSSLTLLGAVVSTHAPLPEVQL 673

  Fly   407 ----ASSIGLAPSQRNLQMEHASTAETYQELCDSDAEMELEEGDEQQQPSQNNVVNPVHTVSPTI 467
                ..|.|.:.|...   .|.||.:.::.|   .|...|||.         ::.:|..|..|  
  Rat   674 LLQQPCSSGRSSSSAT---PHLSTPDGWKAL---PAGPSLEEA---------SLSSPKGTAEP-- 721

  Fly   468 PRNSWLLRQVLRCLEGMRI--------------------PSAVRLECFQVLQAMAT-HIGLLRGH 511
               .||:|   .|:..:.:                    ||.:|||..|||..:|. :..:.:.:
  Rat   722 ---CWLIR---LCISTVVLPKEDSCSGSDAGSALGSTYEPSPMRLEALQVLAHLARGYFSMAQLY 780

  Fly   512 QVRLSRVISAGLTDPATDVKLYAARCLDSVGYQL-GRLLPE----PAER---ELQMSFWLTL--- 565
            .:.|..||...:.:....::|:..:.|:.:|..| .:..|:    |.:|   .:...||..:   
  Rat   781 LMELGEVICKCMCEANPSIQLHGVKLLEELGTGLIQQYKPDSSTAPEQRVPVHMVAMFWTAMLNG 845

  Fly   566 -LPATYEAYDSAGFSLKCALCDALSNMGAISFERLPDGQRTALLAFLSGCASDDHEETLVRVAAL 629
             ||...::.:..  :|:.:.|||||::...:|..||:.::...:..|.|.  :|.:..||:.|..
  Rat   846 PLPRALQSTEHP--TLQASACDALSSILPEAFSSLPNDKQILCITMLLGL--NDSKNHLVKAATS 906

  Fly   630 RAMAVYVLHPSLRTDLGFVENAAELTLRILGDSQLLARIKAAWALGNISDALVAGI----PNQTE 690
            ||:.||||.|.||.|:.||.:.|...|..|.|..|..|.||||:|||::|.|:..:    |:..:
  Rat   907 RALGVYVLFPCLRQDVIFVADTANAILMSLQDKSLNVRAKAAWSLGNLTDTLIVNMDTPDPSFQD 971

  Fly   691 RISAELLERLIQAATKSCADNDKVRANAVRALGNLLQILQVQPLGN---GELMQVAMSKLLDCVT 752
            ..|..||.:::|:|.::..|.|||::||||||||||..||...:..   .|:::.::..|:..|.
  Rat   972 EFSGLLLLKMLQSAIQASTDKDKVKSNAVRALGNLLHFLQPSHIERPRFAEIIEESIQALISTVV 1036

  Fly   753 LPGNAKVKWNACYVIGNLVKHRAF-FANNRLAGILFPTLCQLVVQHANFKVRTNAAGVLLQVKQR 816
            .....||:|||||.:||:.|:.|. ..........:..|..:|:...|||||..:|..|....:|
  Rat  1037 NEAAMKVRWNACYAMGNVFKNPALPLGTAPWTSQAYKALTSVVMSCKNFKVRIRSAAALSVPGRR 1101

  Fly   817 EDFSA--HFPLLWRSLLDALVRSNVLESFEEYNHRDALQQQLCLAIAHLLLLARSSDLPMMRESL 879
            ..:.:  .|..:|.:|:.||.||.....|.|:.:..:|:..:|.|:.|||.||.:||||.::|:|
  Rat  1102 AQYGSLEQFSQIWSALVTALQRSEDTTDFLEFKYCASLRTHVCQALLHLLGLASASDLPCIQETL 1166

  Fly   880  879
              Rat  1167  1166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16989NP_001284761.1 DUF4042 230..406 CDD:289992 68/181 (38%)
HEAT repeat 512..543 CDD:293787 6/31 (19%)
HEAT_2 606..723 CDD:290374 49/121 (40%)
HEAT repeat 607..640 CDD:293787 13/33 (39%)
HEAT repeat 650..680 CDD:293787 14/30 (47%)
ARM 692..810 CDD:237987 43/122 (35%)
HEAT repeat 695..724 CDD:293787 15/29 (52%)
HEAT repeat 740..770 CDD:293787 11/30 (37%)
HEAT repeat 784..812 CDD:293787 9/28 (32%)
HEAT repeat 823..845 CDD:293787 8/22 (36%)
Heatr6NP_001073366.1 HEAT 1 230..269 8/34 (24%)
DUF4042 490..671 CDD:289992 68/181 (38%)
HEAT 2 524..562 17/38 (45%)
HEAT 3 586..624 16/38 (42%)
HEAT 4 630..667 10/37 (27%)
HEAT repeat 885..914 CDD:293787 11/31 (35%)
HEAT repeat 928..957 CDD:293787 14/29 (48%)
HEAT repeat 980..1005 CDD:293787 13/25 (52%)
HEAT repeat 1028..1054 CDD:293787 11/26 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C338209650
eggNOG 1 0.900 E1_KOG2047
Hieranoid 1 1.000
Homologene 1 1.000 H11116
Inparanoid 1 1.050 291 1.000 Inparanoid score I2656
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D106835at2759
OrthoFinder 1 1.000 FOG0007690
OrthoInspector 1 1.000 T1089204
orthoMCL 1 0.900 OOG5_133276
Panther 1 1.100 LDO PTHR13366
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.850

Return to query results.
Submit another query.