DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16989 and Heatr6

DIOPT Version :8

Sequence 1:NP_001284761.1 Gene:CG16989 / 31026 FlyBaseID:FBgn0025621 Length:940 Species:Drosophila melanogaster
Sequence 2:NP_663407.2 Gene:Heatr6 / 217026 MGIID:1919790 Length:1184 Species:Mus musculus

Alignment Length:969 Identity:272/970 (28%)
Similarity:440/970 (45%) Gaps:136/970 (14%)


  Fly    14 AGFWPRLSALTHAKDMDVALLLLQCQDRVLAELEESPEVAEHNQGLVNSLINMHFEGRWLVAKEQ 78
            :|...:||.|:|: |.:|....:.|...:...:...|.:.|..|       ::.|:....:.  |
Mouse   165 SGLLMKLSDLSHS-DPEVRRAAVHCMANLCLSVPGQPYLEEPYQ-------HVCFQAFLTIL--Q 219

  Fly    79 LP-----------LLLAQSLQLIQKLVT--RQPDYAAQRVPELMGLVQCYLQYGAEGETHLKPRK 130
            .|           :||..:|:.||.|:.  :......:.:..|:.:::..:.:|..|.....|..
Mouse   220 SPKSSDMDDITFCMLLQNALKGIQSLLNGGKMRLTQTEHLGALLAVLKKAMFHGLPGLNIEMPAV 284

  Fly   131 LPPAQQSAAYGQEKEEEDQLLAQMSRPCGRKNKVRKMRSLAKQRNQAVNEHHEPNPRERLVLMG- 194
            |.|.......|:...:..|..:..:|....|.|..|:::...|:.:...|..|....|.....| 
Mouse   285 LYPTPLPQYDGRSPVKPQQPESTTARSSANKKKKHKVKTKKTQQGEKAEEEEEEPCGEVEAAPGL 349

  Fly   195 NQDYGCLTGDS-------GENGLP--------------------------SDSDQQQTENKHH-- 224
            :.|...::|:|       |..|||                          |:||....|....  
Mouse   350 SMDQANVSGESAWCSSPWGSQGLPVDGGRAAGREQASLPFASSSWKRVSSSESDYSDAEGGMQGK 414

  Fly   225 -RHQEAKVRISALHLLSTLTNQLPRRSFYGYWHVLFPDGDAGGTPH---LLLLGLKDTNFRCRAL 285
             |..:||||..||....:....:.::..||||....||....|:|.   |:.|.|||.:.:.||.
Mouse   415 MRSYQAKVRQGALACFLSTIKSIEKKVLYGYWSAFVPDTPELGSPQSVSLMTLTLKDPSPKTRAC 479

  Fly   286 ALQVGAQLLYGSKAFLSQA--CSLGPSNFTPFAVSLASSVLTAYRILIAILEREYTPPVLTQCLK 348
            ||||.:.:|.|||.|||.|  .|.....||||:|::|||:...:|.|:..|..|.:...|||.:|
Mouse   480 ALQVLSAILEGSKQFLSVAEDTSDHKRAFTPFSVTIASSIRELHRCLLLALVAESSSQTLTQIIK 544

  Fly   349 CLAVLVQATPFHQLEMGFVYEFVGHVKKLIKSSDPPVAVSALLVMEMLVGTSKLTPEI------A 407
            |||.||...|:::|::..:.:...|:|..|:..|..|.||:|.::..:|.|....||:      .
Mouse   545 CLANLVSNAPYNRLKLSLLTKVWNHIKPYIRHKDVNVRVSSLTLLGAIVSTHAPLPEVQLLLQQP 609

  Fly   408 SSIGLAPSQRNLQMEHASTAETYQELCDSDAEMELEEGDEQQQPSQNNVVNPVHTVSPTIPRNSW 472
            .|.||:.|  :....|.||.:.::..   .|...|||.         ::.:|..:..|     .|
Mouse   610 CSSGLSSS--SSATPHLSTPDGWKTF---PAGSSLEEA---------SLSSPKGSSEP-----CW 655

  Fly   473 LLRQVLRCLEGMRI--------------------PSAVRLECFQVLQAMAT-HIGLLRGHQVRLS 516
            |:|   .|:..:.:                    ||.:|||..|||..:|. :....:.:.:.|.
Mouse   656 LIR---LCISTVVLPKEDSCSGSDAGSALGSTYEPSPMRLEALQVLAHLARGYFSTAQLYLMELG 717

  Fly   517 RVISAGLTDPATDVKLYAARCLDSVGYQL-GRLLPE----PAER---ELQMSFWLTLLPATY-EA 572
            .||...:.:....::|:..:.|:.:|..| .:..|:    |.:|   .|.:.||..:|.... .|
Mouse   718 EVICKCMCEANPSIQLHGVKLLEELGAGLIQQYKPDSNIAPEQRVPVHLVVVFWTAMLSGPLPRA 782

  Fly   573 YDSAGF-SLKCALCDALSNMGAISFERLPDGQRTALLAFLSGCASDDHEETLVRVAALRAMAVYV 636
            ..||.. :|:.:.|||||::...:|..||:.::...:..|.|.  :|.:..||:.|..||:.|||
Mouse   783 LQSAEHPTLQASACDALSSILPEAFSSLPNDKQILCITVLLGL--NDSKNHLVKAATSRALGVYV 845

  Fly   637 LHPSLRTDLGFVENAAELTLRILGDSQLLARIKAAWALGNISDALVAGI----PNQTERISAELL 697
            |.|.||.|:.||.:.|...|..|.|..|..|.||||:|||::|.|:..:    |:..:..|..||
Mouse   846 LFPCLRQDVIFVADTANAILMSLQDKSLNVRAKAAWSLGNLTDTLIVNMDTPDPSFQDEFSGLLL 910

  Fly   698 ERLIQAATKSCADNDKVRANAVRALGNLLQILQ---VQPLGNGELMQVAMSKLLDCVTLPGNAKV 759
            .:::|.|.::..|.|||::||||||||||..||   |:.....|:::.::..|:..|......||
Mouse   911 LKMLQCAIQASTDKDKVKSNAVRALGNLLHFLQPSHVERPRFAEIIEESIQALISTVVNEAAMKV 975

  Fly   760 KWNACYVIGNLVKHRAF-FANNRLAGILFPTLCQLVVQHANFKVRTNAAGVLLQVKQREDFSA-- 821
            :|||||.:||:.|:.|. ..........:..|..:|:...|||||..:|..|....:|..:.:  
Mouse   976 RWNACYAMGNVFKNPALPLGTAPWTSQAYKALTSVVMSCKNFKVRIRSAAALSVPSKRGQYGSLE 1040

  Fly   822 HFPLLWRSLLDALVRSNVLESFEEYNHRDALQQQLCLAIAHLLLLARSSDLPMMRESLE 880
            .|..:|.:|:.||.:|.....|.|:.:..:|:..:|.|:.|||.||.:||||.::|:|:
Mouse  1041 QFIQIWSALVTALQKSEDTTDFLEFKYCASLRTHICQALLHLLSLASASDLPGIQETLK 1099

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16989NP_001284761.1 DUF4042 230..406 CDD:289992 68/181 (38%)
HEAT repeat 512..543 CDD:293787 6/31 (19%)
HEAT_2 606..723 CDD:290374 49/121 (40%)
HEAT repeat 607..640 CDD:293787 13/33 (39%)
HEAT repeat 650..680 CDD:293787 14/30 (47%)
ARM 692..810 CDD:237987 44/122 (36%)
HEAT repeat 695..724 CDD:293787 15/29 (52%)
HEAT repeat 740..770 CDD:293787 11/30 (37%)
HEAT repeat 784..812 CDD:293787 9/28 (32%)
HEAT repeat 823..845 CDD:293787 7/22 (32%)
Heatr6NP_663407.2 HEAT 1 159..198 8/34 (24%)
DUF4042 421..602 CDD:289992 68/181 (38%)
HEAT 2 455..493 17/38 (45%)
HEAT 3 517..555 16/38 (42%)
HEAT 4 561..598 10/37 (27%)
HEAT repeat 817..846 CDD:293787 11/31 (35%)
HEAT repeat 860..889 CDD:293787 14/29 (48%)
HEAT repeat 912..937 CDD:293787 13/25 (52%)
HEAT repeat 960..986 CDD:293787 11/26 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C338208981
eggNOG 1 0.900 E1_KOG2047
Hieranoid 1 1.000
Homologene 1 1.000 H11116
Inparanoid 1 1.050 292 1.000 Inparanoid score I2740
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007690
OrthoInspector 1 1.000 T1085661
orthoMCL 1 0.900 OOG5_133276
Panther 1 1.100 LDO PTHR13366
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5863
TreeFam 1 0.960
1110.870

Return to query results.
Submit another query.