DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16989 and syf-1

DIOPT Version :8

Sequence 1:NP_001284761.1 Gene:CG16989 / 31026 FlyBaseID:FBgn0025621 Length:940 Species:Drosophila melanogaster
Sequence 2:NP_491250.1 Gene:syf-1 / 171970 WormBaseID:WBGene00016837 Length:855 Species:Caenorhabditis elegans

Alignment Length:497 Identity:90/498 (18%)
Similarity:148/498 (30%) Gaps:203/498 (41%)


  Fly   453 QNNVVNPVHTVSPTIPRNSW--LLRQVLRCLEGMRIPSAVRL-ECF------------------- 495
            ::.:||...|      .|||  |.....|||  ||:....|: .|:                   
 Worm    86 ESTIVNKCPT------DNSWRALCDTYERCL--MRLHKMPRIWICYCEVMIKRGLITETRRVFDR 142

  Fly   496 --------QVLQAMATHIGLLRGHQVRLSRVISAGLTDPATDVKLYAARCL--------DSVGYQ 544
                    |.::....:||.|..|.:            |.|.:::| .|.|        |.|.|.
 Worm   143 ALRSLPVTQHMRIWTLYIGFLTSHDL------------PETTIRVY-RRYLKMNPKAREDYVEYL 194

  Fly   545 LGRLLPEPAERELQM----------------SFWLTLL--------------------PATYEAY 573
            :.|...:.|.:||..                ..|..|.                    ...|...
 Worm   195 IERDQIDEAAKELTTLVNQDQNVSEKGRTAHQLWTQLCDLISKNPVKIFSLNVDAIIRQGIYRYT 259

  Fly   574 DSAGFSLKCALCDALSNMGAISFERLPDGQRTALLAFLSGCASDDHEETLVRVAALRAMA-VYVL 637
            |..|| |.|:|.|..  :.:..|||                |.|.:||.:.:|:.:|..| ||..
 Worm   260 DQVGF-LWCSLADYY--IRSAEFER----------------ARDVYEEAIAKVSTVRDFAQVYDA 305

  Fly   638 HPSLRTDLGFVENAAELTLRIL---GDSQLLARIKAAW-------ALGNISDALVAGIPNQTERI 692
            :.:      |.|....:.::.:   ||.:  ..:...|       .:...::.:.:.:..|....
 Worm   306 YAA------FEEREVSIMMQEVEQSGDPE--EEVDLEWMFQRYQHLMERKNELMNSVLLRQNPHN 362

  Fly   693 SAELLERL-------------IQAATKSCADNDKVRANAVRALGNLLQILQVQPLGNGELMQVAM 744
            ..|.|.|:             .:.|.||.  |.|::...||.|                  .:.:
 Worm   363 VGEWLNRVNIYEGNYNKQIETFKEAVKSV--NPKIQVGKVRDL------------------WIGL 407

  Fly   745 SKLLDCVTLPGNAKVKWNACYVIGNLVKHRAFFAN---NRLAGILFPTLCQLVVQHANFKVRTNA 806
            :||.:     .|           |:|...|..|..   ::..|:  ..|..:...:|..:::...
 Worm   408 AKLYE-----DN-----------GDLDAARKTFETAVISQFGGV--SELANVWCAYAEMEMKHKR 454

  Fly   807 AGVLLQVKQR----------EDFSA------HFPLLWRSLLD 832
            |...|.|.||          |:..:      ..|:||....|
 Worm   455 AKAALTVMQRACVVPKPGDYENMQSVQARVHRSPILWAMYAD 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16989NP_001284761.1 DUF4042 230..406 CDD:289992
HEAT repeat 512..543 CDD:293787 7/39 (18%)
HEAT_2 606..723 CDD:290374 26/141 (18%)
HEAT repeat 607..640 CDD:293787 9/34 (26%)
HEAT repeat 650..680 CDD:293787 3/40 (8%)
ARM 692..810 CDD:237987 22/134 (16%)
HEAT repeat 695..724 CDD:293787 11/42 (26%)
HEAT repeat 740..770 CDD:293787 4/30 (13%)
HEAT repeat 784..812 CDD:293787 5/28 (18%)
HEAT repeat 823..845 CDD:293787 4/11 (36%)
syf-1NP_491250.1 TPR 178..465 CDD:223533 63/352 (18%)
TPR repeat 362..391 CDD:276809 6/29 (21%)
TPR repeat 396..428 CDD:276809 10/66 (15%)
TPR repeat 521..551 CDD:276809
TPR <526..704 CDD:223533
TPR repeat 558..589 CDD:276809
AAT_I <655..>701 CDD:302748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.