DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16989 and heatr6

DIOPT Version :8

Sequence 1:NP_001284761.1 Gene:CG16989 / 31026 FlyBaseID:FBgn0025621 Length:940 Species:Drosophila melanogaster
Sequence 2:XP_002939678.1 Gene:heatr6 / 100487263 XenbaseID:XB-GENE-5772465 Length:1174 Species:Xenopus tropicalis

Alignment Length:892 Identity:258/893 (29%)
Similarity:410/893 (46%) Gaps:124/893 (14%)


  Fly    82 LLAQSLQLIQKLV--TRQPDYAAQRVPELMGLVQCYLQYGAEGETHLKPRKLPPAQQSAAYGQEK 144
            ||..:|:.||.|:  ::.......::..|:.:::.|:.:|..|.:...|..|.|...:...|:..
 Frog   242 LLQNALKGIQSLLNGSKMKLLETGQLGSLLAVLKKYMFHGLPGLSIEMPSVLYPTPLAQYDGRSP 306

  Fly   145 EEEDQLLAQMSRPCGRKNKVRKMRSLAKQRNQAVNEHHEPNPRERL---------------VLMG 194
            .:.:|..|.:::|...|.|    |.:.||:    ..||....:|.|               :..|
 Frog   307 TKPEQPEANVNQPTWNKKK----RKVGKQK----KGHHGEESKEELKNEIGAEINRFEKMRLCAG 363

  Fly   195 NQDYGCLTGDSGENGLP----------------------SDSDQQQTE----NKHHRHQEAKVRI 233
            ........|.......|                      |||:....|    || .|..:||||.
 Frog   364 EAQCNLYLGPQKSPLKPHQGQAEKDQISPQVQRYKMMNSSDSEYSDAEGSLQNK-IRSFQAKVRQ 427

  Fly   234 SALHLLSTLTNQLPRRSFYGYWHVLFPDGDAGGTPH---LLLLGLKDTNFRCRALALQVGAQLLY 295
            .||....:....:.::..||||....||....|:|.   |:.:.|||::.:.||.||||.:.:|.
 Frog   428 GALSCFLSTIKSIEKKVLYGYWSAFVPDISGIGSPQSVSLMTIALKDSSPKTRACALQVLSAILD 492

  Fly   296 GSKAFLSQACSLGPSN--FTPFAVSLASSVLTAYRILIAILEREYTPPVLTQCLKCLAVLVQATP 358
            |||.|||.|.......  |||.:|:||||:...:|.|:..:..|.:...|||.:||||.||...|
 Frog   493 GSKQFLSVADDANDHKRAFTPLSVTLASSIRELHRCLLLAIVAESSAQTLTQIIKCLANLVSNAP 557

  Fly   359 FHQLEMGFVYEFVGHVKKLIKSSDPPVAVSALLVMEMLVGTSKLTPEIASSIGLAPSQRNLQMEH 423
            :|:|:.|.:......:|..|::.|..|.||:|.::..:|......||:         |..||...
 Frog   558 YHRLKPGLLTRVWNQIKHYIRNKDVNVRVSSLTLLGAIVSAQVPLPEV---------QLLLQQPV 613

  Fly   424 ASTAETYQELCDSDAEMELEEGDEQQQPSQNNVVNPVHTVSPTIPRNSWLLRQVLRCLEGMR--- 485
            .|.::.......:|.|...:|...:.|  :.|.::..|:.|    .:.||:|..:..:...|   
 Frog   614 YSLSQNSGSATPNDPESSRKESLLEGQ--KKNGLHSEHSQS----ESCWLIRLCITLVVEPREDP 672

  Fly   486 --------------IPSAVRLECFQVLQAMAT-HIGLLRGHQVRLSRVISAGLTDPATDVKLYAA 535
                          .||.||||..|||..:.. :..:.:.:.:.|..|....:.:....|:|:.|
 Frog   673 YSDSEASSTQAVIYEPSPVRLEALQVLACLVKGYFNMAQSYLIELGEVACKCMQETDASVQLHGA 737

  Fly   536 RCLDSVGYQLGRLLPEPAEREL----------QMSFWLTL----LPATYEAYDSAGFSLKCALCD 586
            :.|:.:|  .|.:..:..:..:          .::||..:    |||..:  :....:|:.:.||
 Frog   738 KLLEELG--TGIIQQQKPDSVVPINLRVPINQAVTFWNMILNGPLPAALQ--NEQHPTLQTSACD 798

  Fly   587 ALSNMGAISFERLPDGQRTALLAFLSGCASDDHEET-LVRVAALRAMAVYVLHPSLRTDLGFVEN 650
            |||::...:|..|||.::...:..|.|.   :|.|. ||:.||.||:.||:|.|.||.|:.||.:
 Frog   799 ALSSVLPEAFSNLPDDRQILCITLLLGL---NHSENPLVKAAAARALGVYILFPCLRQDVMFVAD 860

  Fly   651 AAELTLRILGDSQLLARIKAAWALGNISDALVAGI----PNQTERISAELLERLIQAATKSCADN 711
            .|...|..|||.....|.||||:|||::|:|:..:    .:..|..|..||.:::.:||::..|.
 Frog   861 TANAILMSLGDRSPNVRAKAAWSLGNLTDSLIVNMEAMGQSFQEEFSDMLLLKMLWSATEASKDK 925

  Fly   712 DKVRANAVRALGNLLQILQ----VQPLGNGELMQVAMSKLLDCVTLPGNAKVKWNACYVIGNLVK 772
            |||::||||||||||..||    |:| ...|.::.|:..|:..|...|..||||||||.:||:.|
 Frog   926 DKVKSNAVRALGNLLHFLQPYHIVKP-RFCESIECAIQALVSTVLGDGTMKVKWNACYALGNVFK 989

  Fly   773 HRAF-FANNRLAGILFPTLCQLVVQHANFKVRTNAAGVLLQVKQREDFSA--HFPLLWRSLLDAL 834
            :.|. ..........:..|..:|....|||||..:|..|.....||.:.:  .:..:|.:|:.||
 Frog   990 NTALPLGKAAWTASAYSALTTVVKACKNFKVRIKSAMALSIPFSREQYGSTEQYCNIWNALVTAL 1054

  Fly   835 VRSNVLESFEEYNHRDALQQQLCLAIAHLLLLARSSDLPMMRESLEE 881
            .:|...|.|.|:.:..:|::|:|.|:.|||.||...|||.:|::|.|
 Frog  1055 QKSEDTEDFLEFKYSASLREQICQALIHLLSLASQEDLPGIRKTLLE 1101

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16989NP_001284761.1 DUF4042 230..406 CDD:289992 65/181 (36%)
HEAT repeat 512..543 CDD:293787 7/31 (23%)
HEAT_2 606..723 CDD:290374 50/122 (41%)
HEAT repeat 607..640 CDD:293787 14/34 (41%)
HEAT repeat 650..680 CDD:293787 14/30 (47%)
ARM 692..810 CDD:237987 48/123 (39%)
HEAT repeat 695..724 CDD:293787 15/29 (52%)
HEAT repeat 740..770 CDD:293787 14/30 (47%)
HEAT repeat 784..812 CDD:293787 9/28 (32%)
HEAT repeat 823..845 CDD:293787 7/22 (32%)
heatr6XP_002939678.1 DUF4042 424..605 CDD:289992 65/181 (36%)
HEAT repeat 814..847 CDD:293787 12/36 (33%)
HEAT_2 821..937 CDD:290374 50/119 (42%)
HEAT_EZ 832..887 CDD:290247 28/55 (51%)
HEAT repeat 861..890 CDD:293787 14/29 (48%)
HEAT repeat 905..938 CDD:293787 16/33 (48%)
HEAT repeat 957..987 CDD:293787 14/30 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C338209298
eggNOG 1 0.900 E1_KOG2047
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H11116
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D106835at2759
OrthoFinder 1 1.000 FOG0007690
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.800

Return to query results.
Submit another query.