DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16989 and xab2

DIOPT Version :8

Sequence 1:NP_001284761.1 Gene:CG16989 / 31026 FlyBaseID:FBgn0025621 Length:940 Species:Drosophila melanogaster
Sequence 2:NP_001135604.1 Gene:xab2 / 100216162 XenbaseID:XB-GENE-1009276 Length:839 Species:Xenopus tropicalis

Alignment Length:117 Identity:30/118 (25%)
Similarity:48/118 (41%) Gaps:25/118 (21%)


  Fly   117 QYGAEGETHLKPRKLPPAQQSAAYG-QEKEEEDQLL----------AQMSRPCGRKNKVRKMRSL 170
            :|..:| |.|..:||..|:..|:.| .|..:|.|.|          |:..:| ..|.|:..:||.
 Frog   724 KYNTQG-TFLVSQKLRAAEGGASEGINEPADEMQALEQRAAVIAAEAEKDKP-QMKEKILFVRSD 786

  Fly   171 AKQRNQAVNEHHEPNPRERLVLMGNQDYGCLTGDSGENGLPSDSDQQQTENK 222
            | .|::......:.||.|..:           |:..|:....:.|:.|.|.|
 Frog   787 A-SRSELAELTRQSNPDEINI-----------GEDDESEEELEPDEVQLEQK 826

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16989NP_001284761.1 DUF4042 230..406 CDD:289992
HEAT repeat 512..543 CDD:293787
HEAT_2 606..723 CDD:290374
HEAT repeat 607..640 CDD:293787
HEAT repeat 650..680 CDD:293787
ARM 692..810 CDD:237987
HEAT repeat 695..724 CDD:293787
HEAT repeat 740..770 CDD:293787
HEAT repeat 784..812 CDD:293787
HEAT repeat 823..845 CDD:293787
xab2NP_001135604.1 PilF 416..615 CDD:225605
TPR repeat 424..452 CDD:276809
TPR repeat 457..504 CDD:276809
TPR repeat 509..537 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.