DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sdk and dscamb

Sequence 1:NP_001284756.1 Gene:sdk FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:XP_009289749.1 Gene:dscamb ZFINID:ZDB-GENE-031118-67 Length:2020 Species:Danio rerio

Alignment Length:1504 Identity:365/1505 (24%)
Similarity:566/1505 (38%) Gaps:325/1505 (22%)


  Fly    66 QQQLQAPRFTTHPSSSGSIVSEGSTK---------ILQCHALGYPQPTYRWLKDGVPVGDFSSSQ 121
            :|...|....:.|..|..::.:|..:         .|.|.|.|:|.|.||||:|..|:.  |.|:
Zfish   208 RQSNSARLLLSEPVDSAPVILDGFERKEVMVGHRVELPCKASGHPPPRYRWLRDNSPLE--SDSR 270

  Fly   122 FYR------FHSTRREDAGSYQCIARNDAG-------------------------------SIF- 148
            :::      ..:||..|||||.|...|..|                               |:| 
Zfish   271 YHQSVSGLLIEATRPSDAGSYVCEVWNSFGNAKVVGRLVVKQPLKAVVSPRKVRGSVGSQVSLFC 335

  Fly   149 ----SEKSDVV------VAYMGI--------FEN-----------------------TTEGRLTV 172
                |::.|:.      ..|.||        .||                       :|:..:.|
Zfish   336 SVTGSDEFDITWYRNAEKIYQGINVRITGINNENLVMEGMAKSDGGAYQCFARNGKMSTQDLVQV 400

  Fly   173 I--SGHPAIFD------MPPIESI---------PVPSVMWQSEDGPLNYDIKYAF-----THANQ 215
            :  .|.|.|..      :.|.|.|         |:|:|.|..:|.|:..|..:..     |..:.
Zfish   401 VLEDGTPKILSAFSEKVVSPNEPISLVCHVKGTPLPTVTWTLDDDPVIKDSNHRMDRIITTEGHV 465

  Fly   216 LIILSADE---NDRKGYRAKAINTQLGKEESSAFVHLNVSGDPYIEVAPEIIVRPQDVKVKVGTG 277
            |..|:...   :|...||. ..|...|.....|  .:||.|...|        ||......:...
Zfish   466 LSYLNVSHTQVSDGGVYRC-TCNNSAGSVSYQA--RINVRGPASI--------RPMKNVTAIAGR 519

  Fly   278 VVELQCIANARPLHELETLWLKDGLAVETAGVRHTLNDPWNRTLALLQANSSHSGEYTCQVRLRS 342
            ...:.|.....|.:.::  |.||...:.....:....:  |.||.|....:|..|||||.|.:  
Zfish   520 DTYIHCRIIGYPYYSIK--WYKDSNLLPFNHRQRAFEN--NGTLKLSNVQNSDEGEYTCYVLV-- 578

  Fly   343 GGYPAVSASARLQILEPPLF-FTPMRAETFGEFGGQVQLTCDVVGEPTP-QVKWFRNAESVDAHI 405
            .....:..|..:.:..|||. .:..::.:.|:   :|.:.|.|:....| .:.|.::...::|.:
Zfish   579 DPEKQIHRSVHVTVKVPPLIQHSDSQSASIGQ---RVFIPCVVISGDLPMSITWHKDGRPINASL 640

  Fly   406 ESGRYTLNTDNTLVIKKLILDDAAMFQCLAINEAGENSASTWLRVKTKTAKNRVKRLAQPRILRV 470
            ......::..::|.|..|.......:.|:|.|||.....|..|.||.                  
Zfish   641 GVTIDNIDFTSSLRISNLSEIHNGSYTCIARNEAAAVEHSIQLIVKV------------------ 687

  Fly   471 RASHAGLGSEKGSESGSSDRRKEFRFASAPIMELPPQNVTALDGKDATISCRAVGSPNPNITWIY 535
                                        .|..|:.|::...:.||..|::|.|.|:|.|.|.|.:
Zfish   688 ----------------------------PPHFEVQPKDQDGIYGKSVTLNCSAKGNPIPTIVWNH 724

  Fly   536 NE----TQLVDIS----SRVQILESGDLLISNIRSVDAGLYICVRANEAGS-VKGEAYLSVLVRT 591
            ::    .|...|:    ||||:||:|.|||.::...|||.|:|..:|:.|: :....||:|.:..
Zfish   725 SKGAGVPQFQPIALNSGSRVQLLENGSLLIKHVLEEDAGFYLCKVSNDVGADISKSMYLTVKIPA 789

  Fly   592 QIIQPPVDTTVLLGLTATLQCKVSSDPSVPYNIDWYREGQSSTP-----ISNSQRIGVQADGQLE 651
            .|...|..|....|....:.|....:.  |..:.|.:|.....|     :...:.:|.:....|:
Zfish   790 MITSYPNTTRAEQGHMTEMSCTAHGEK--PIKVRWEKESHIINPDMSRYVVTVKEVGDEVISTLQ 852

  Fly   652 IQAVRASDVGSYACVVTSPGGNETRAARLSVIELPFPPSNVKVERLPEPQQRSINVSWTPGFDGN 716
            |......|.|.::|:..:..|.:....:|.|.:.|.||   :|| :.|.:.|:|.:.||.|||||
Zfish   853 ILHTVREDSGFFSCIAINSYGEDKGIIQLIVQDRPDPP---EVE-IREVKDRTIALRWTMGFDGN 913

  Fly   717 SPISKFIIQRREVSELGPVPDPLLNWITE--LSNVSADQRWILLENLKAATVYQFRVSAVNRVGE 779
            |||:.:.|..:..|         .:|.:.  ..:||.......:..|..|:.|..|:.|.|::||
Zfish   914 SPITGYDINYKNKS---------ASWASSQMTKDVSPQLNQATIIELHPASTYNIRMFAKNQIGE 969

  Fly   780 GSPSEPSN--VVELPQEAPSGPPVGFVGSARSMSEIITQWQPPLEEHRNGQILGYILRYRLFGYN 842
               |.|||  .:...:..|.|.|......|.|...|...|:||.:..:||.|..|.:.||.||..
Zfish   970 ---SRPSNELTITTDEAPPDGAPQDVQLEAISSQGIKVTWKPPHKHLQNGLIRSYQVCYREFGTG 1031

  Fly   843 NVPWSYQNI---TNEAQRNFLIQELITWKDYIVQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPTN 904
            ..| .|..|   |........:..|..:..|.|::.|.|..|:|..:|...|.|.|.||..||.|
Zfish  1032 GSP-QYNTINVDTTGDIETLTLDNLKKYTQYEVRVQAANRAGMGPTSEEITITTLEDVPSRPPEN 1095

  Fly   905 VKVEAINSTAARCRWTPPNPQQINGINQGYKIQAWQRRLIDGEWRDIERRMKTVPPSLIDPLAEQ 969
            |...|.........|:....:.:||:..||::..| ..|.|||..:| |.:.|..|||       
Zfish  1096 VVTTATTPETISLSWSALPKEALNGMLLGYRVIFW-ANLPDGELGEI-RNITTTKPSL------- 1151

  Fly   970 TAILGGLEKFTEYNISVLCFTDPGDGVASSQVAVMTMDDVPDEVTGLHFDDVSDRSVKVLWAPPR 1034
              .|..|||:|.|:|.||.||..||||.|.|:...|.:|||....|:.....:...|.|.|.||.
Zfish  1152 --ELERLEKYTNYSIQVLAFTRAGDGVRSEQIYTRTKEDVPGPPAGVKAAASTSSVVFVSWLPPH 1214

  Fly  1035 ASNGILTGYTVRYQVKDRPDTLKSFNLTADDTELTVNQLQATTHYWFEIVAWTRVGSGIPKTATI 1099
            ..|||:..|.| :.....|..:..|....|.....:..|.....|...:||.|..|.|       
Zfish  1215 KLNGIIRKYIV-FCSNPYPTVISEFEAAPDVYFRRLTNLNQNWQYSIWVVAVTAAGRG------- 1271

  Fly  1100 QSGVEPVLPHAPTALALSNIEAFS----------VVLQFTPGFDGNSSITKW-----------KV 1143
              ....::...|.|.|.:.|..||          :||......|...:| ||           .:
Zfish  1272 --NTSEIITVEPQAKAPARILTFSGTVTTPWMRDIVLPCKAVGDPPPTI-KWLKGNNGTPAPVSI 1333

  Fly  1144 EG-QTARNMTWFTICEINDPDAETLTVTGLVPFTQYRLRLSASNVVGSSKPSEATKDFQTIQARP 1207
            :| ::|.|...|.|..:...|:.             ..|..|||..||   .|...:.| :|..|
Zfish  1334 DGRRSAHNNGSFVIRTVKAEDSG-------------YYRCVASNNWGS---DEIMLNLQ-VQVPP 1381

  Fly  1208 KHPPFNVTVRAMSAQQLRVRWIPLQQTEWYGNP-----RGYNISYKQ-LVKTPGTIKYVPRSVVI 1266
            ..|  .:||...:...:.:.|||       |:.     |||.:.|.: ..:..|:....|     
Zfish  1382 DQP--RLTVTKTTTTSITLFWIP-------GDNGGSSIRGYILQYSEDNSEEWGSYSISP----- 1432

  Fly  1267 EDHTANSHVLDSLEEWTLYEVKMNACNDVGCSKESDTAVERTREAVPSYGPLDVQANATSSTTV- 1330
               :..|:.|::|:..|.|:..:.|.|.||..:.|:....:|....|.:.......::.:||.| 
Zfish  1433 ---SERSYRLENLKCGTWYKFTLTAQNAVGPGRISEIIEAKTHGKEPQFAKDHELFSSINSTRVE 1494

  Fly  1331 --VVQWGEVPRQHRNG--QIDGYKVFYAAADRGQQVLHKTIPNNATFTTTLTELKKYVVYHVQVL 1391
              ::.|       .||  .||.:.:.|...|..:..:.|.  ::.|.:..|.:|::...|.:|: 
Zfish  1495 LNLIGW-------NNGGCPIDSFTLEYRPVDTTKWTMVKR--DSLTKSHILYDLQEATWYELQM- 1549

  Fly  1392 AYTRLGNGA 1400
               |:||.|
Zfish  1550 ---RVGNSA 1555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig 71..157 CDD:299845 32/143 (22%)
I-set 72..150 CDD:254352 30/129 (23%)
Ig 172..245 CDD:299845 22/98 (22%)
IG_like 280..356 CDD:214653 17/76 (22%)
Ig 280..343 CDD:299845 16/63 (25%)
IG_like 375..450 CDD:214653 16/76 (21%)
Ig 378..447 CDD:143165 15/70 (21%)
Ig 506..587 CDD:299845 32/90 (36%)
IG_like 506..587 CDD:214653 32/90 (36%)
I-set 592..682 CDD:254352 17/95 (18%)
Ig 595..682 CDD:299845 16/92 (17%)
FN3 686..789 CDD:238020 35/107 (33%)
FN3 798..893 CDD:238020 29/98 (30%)
FN3 901..1005 CDD:238020 38/104 (37%)
fn3 1011..1094 CDD:278470 21/83 (25%)
FN3 1108..1202 CDD:238020 26/116 (22%)
FN3 1210..1308 CDD:238020 23/104 (22%)
fn3 1317..1402 CDD:278470 20/90 (22%)
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
dscambXP_009289749.1 I-set 132..198 CDD:254352
I-set 225..310 CDD:254352 25/87 (29%)
IGc2 239..300 CDD:197706 23/63 (37%)
IG_like 320..400 CDD:214653 10/80 (13%)
IGc2 328..391 CDD:197706 9/63 (14%)
IG_like 417..501 CDD:214653 20/87 (23%)
Ig 424..498 CDD:143165 17/77 (22%)
IG_like 511..592 CDD:214653 17/87 (20%)
IGc2 518..576 CDD:197706 15/62 (24%)
I-set 595..685 CDD:254352 20/93 (22%)
Ig 612..682 CDD:143165 15/70 (21%)
I-set 689..785 CDD:254352 34/96 (35%)
Ig7_DSCAM 706..785 CDD:143211 29/79 (37%)
IG_like 795..883 CDD:214653 16/90 (18%)
Ig 803..890 CDD:299845 17/89 (19%)
FN3 887..980 CDD:238020 35/109 (32%)
FN3 987..1084 CDD:238020 29/98 (30%)
FN3 1092..1185 CDD:238020 38/104 (37%)
FN3 1190..1279 CDD:238020 22/99 (22%)
IGc2 1302..1367 CDD:197706 16/79 (20%)
FN3 1398..1471 CDD:238020 20/88 (23%)
FN3 1485..1557 CDD:238020 20/85 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.