DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sdk and Osmr

Sequence 1:NP_001284756.1 Gene:sdk FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:NP_001005384.1 Gene:Osmr RGDID:1302983 Length:962 Species:Rattus norvegicus

Alignment Length:1146 Identity:238/1147 (21%)
Similarity:378/1147 (33%) Gaps:360/1147 (31%)


  Fly  1180 LRLSASNVVGSSKPSEATKDFQTIQARPKHPPFNV--TVRAMSAQQLRVRW------IPLQQTEW 1236
            ||.|.|.|:|  :|.:.|.:..|:..:......|:  ||...|.|:|.:.:      :....|.|
  Rat    19 LRTSQSKVLG--EPLQLTPEIHTVSLQSALQEANLEWTVPTFSHQELNIVFQIEISRMRTSNTIW 81

  Fly  1237 YGNPRGYNISYKQLVKTPGTIKYVPRSVVIEDHTANSHVLDSLEEWTLYEVKMNACNDVGCSKES 1301
            .||       |...||...|:.:                     :||         :|:  ..|.
  Rat    82 VGN-------YSTTVKHEETVHW---------------------KWT---------SDI--PLEC 107

  Fly  1302 DTAVERTREAVPSYGPLDVQANATSSTTVVVQWGEVPRQHRNGQI----DGYKVFYAAADRGQQV 1362
            .|...|.|..|.     |.|....||.:....|.||     |.|:    |...:|  ..||   :
  Rat   108 ATHFIRIRAMVD-----DAQYPPQSSWSNWSSWKEV-----NAQVSVPPDTLLIF--PEDR---L 157

  Fly  1363 LHKTIPNNATFTTTLTELKKYVVYHVQVLAYTRLGNGALSTPPIRVQTFEDTPGVPSNVSFPDVS 1427
            |.:  .:|.|....:.:    .:|:|..         .|...|||.:..:      |::|.  :.
  Rat   158 LEE--GSNVTICLMIGQ----NLYNVSC---------KLQEEPIRGEQLD------SHLSL--IK 199

  Fly  1428 LTMARIIWDVPVDPNGKILAYQVTYTLNG-----------SAMLNYSREFPPSDRTFRATELL-- 1479
            |.....:.:...:.|.|        .:||           |.:|...:.|....|.|:....|  
  Rat   200 LNNVVFLNNAGTNINCK--------AMNGTKNTFGTVLFVSKVLEEPKNFSCETRDFKTLNCLWE 256

  Fly  1480 PGKYYSFSCTAQTRLGWGKIATALVYTTNNRERPQAPSVPQISRSQIQAHQITFSWTPGRDGFAP 1544
            ||        ..|.|.|.|                       .|||   |...:....||     
  Rat   257 PG--------IDTTLSWHK-----------------------QRSQ---HYTLYESFSGR----- 282

  Fly  1545 LRYYTVEMRENEGRWQPLPERVDPSLSSFTAVGLRPYMTYQFRIQATNDLGPSAFSRESVIV--- 1606
               ..|....|...||...:..:               ||.|.:.|.|:|     .:.||.:   
  Rat   283 ---REVSNHRNSHTWQITEDSQE---------------TYNFTLTAENNL-----RKRSVSISFN 324

  Fly  1607 ---RTLPAAPAVGVGGLKVVPITTTSVRVQWSALETALWNGDASTGGYRILYQQLSDFPTALQST 1668
               |..|.||    ..:.:..:..|...:.|..         .|.|.|.:|.|      ..||..
  Rat   325 LTHRVHPKAP----HDVTLKTVGATKAHMTWKV---------PSRGDYTLLCQ------VELQCE 370

  Fly  1669 PKTDVHGINENSV--------VLSDLQQDRNYEIVV--------------LPFNSQGPGPATPPA 1711
            .:.    |:|::|        :.|||:.|..|:..|              :....:.| .|.|..
  Rat   371 GEV----IHEHNVSVHTSANYLFSDLEPDTEYKACVRCASANHFWKWSDWMQKKFRTP-EAAPSE 430

  Fly  1712 AVYVGEAVPTGEPRAVDAAPISSTEVRLLWKPPKQSMQNGDILGYKIYYLVTYSPQALEPGRKWE 1776
            |:.|...|.|...|.|         |.|.|||..:|..||.|:.|.|......:|.        |
  Rat   431 ALDVWRDVRTENGRHV---------VTLFWKPLLKSQANGKIISYNIVVENEANPT--------E 478

  Fly  1777 EEIEVVSATATSHSLVFLDKFTEYRIQLLAFNPAGDGPRS----------APITVKTLPGVPSAP 1831
            .|...|.|.|...:| .|| ...|:|.:.|.|.||..|.|          ..:..||:.|:.:  
  Rat   479 SEQYSVRAPALGTNL-SLD-LHPYKIHISANNSAGASPESLVVLSSHSGHEEVHEKTIKGIKN-- 539

  Fly  1832 LHLRFSDITMQSLEVTWDPPKFLNGEILGYLV---TYETTEENEKFSKQVKQKVSNTTLRVQNLE 1893
                       ...::|:|   ::|:.:||:|   .:..|:..:...|.|...:::|.:.....|
  Rat   540 -----------GFNISWEP---VSGDAIGYVVDWCAHSQTQRCDLQWKNVGPNITSTIITSDAFE 590

  Fly  1894 EEVTYTFTVRAQTSVDYGPGISENVTTGPQDGSP-VAPRDLILTKTLSSVEMHWINGPSG--RGP 1955
            ..|.|.|.: .:.||:....:.|......|:.:| |.|...|...|.:|..:.|.:..|.  .|.
  Rat   591 PGVRYNFRI-FERSVEENVRLVEKQRGYTQELAPSVNPGVTIHNLTPNSFSLKWQDYASDFQSGF 654

  Fly  1956 ILGYLIEAKKRD---DSRWTKIEQTRKGMMQDF--------TVSYHILMPSTAYTFRVIAYNRYG 2009
            |.|||:..|.::   :..|.:...:.|.::..:        |::...|.|.:.|.|.|..|...|
  Rat   655 IKGYLVYLKSKELQCNPNWERTVLSDKSVLCKYDVDDPETKTLTVENLRPESLYEFLVTPYTSAG 719

  Fly  2010 ISFPVYSKDSILTPS-KLHLEYGYLQHKPFYRQTWFMVSLAATSIVIIVMVIAV-----LC---- 2064
             ..|..:...:.||. :.|:   .||                   :|:.|.:.|     :|    
  Rat   720 -QGPNETYTKVTTPDVRSHM---LLQ-------------------IILPMTLGVFLSIIVCYWKS 761

  Fly  2065 --VKSKSY-----KYKQEAQKTLEES----MAMSIDERQELALELYRSRHG-----VGTGTLNSV 2113
              ||.|.|     .||......::..    :.|::.:.....||:.....|     ||:|.|::.
  Rat   762 QWVKEKCYPDIPNPYKSSILSLIKSKKNPHLIMNVKDCIPDVLEVINKAEGSKTQCVGSGKLHTE 826

  Fly  2114 GTLRSGTLGTLGRKSTSRPPPGVHLGK-----------------SPPRPSPASVAYHSDEESLKC 2161
            .......| ....|.:|.|.|.|.|..                 .|.:.:|..:...:....|:.
  Rat   827 DVPTKPPL-VPTEKDSSGPMPFVFLENFTYDQSAFDSGSHGFIPGPLKNTPHQLGLLAPPNKLQN 890

  Fly  2162 YDENPDDSSVTEKPSEVSS----SEASQHSESENESVRSDP 2198
            ..||....|:.|.|:|.:|    |:.:.....:.:|:.::|
  Rat   891 VLENDYMKSLVESPTEETSLIYVSQLASPICGDKDSLVTNP 931

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845
IG_like 280..356 CDD:214653
Ig 280..343 CDD:299845
IG_like 375..450 CDD:214653
Ig 378..447 CDD:143165
Ig 506..587 CDD:299845
IG_like 506..587 CDD:214653
I-set 592..682 CDD:254352
Ig 595..682 CDD:299845
FN3 686..789 CDD:238020
FN3 798..893 CDD:238020
FN3 901..1005 CDD:238020
fn3 1011..1094 CDD:278470
FN3 1108..1202 CDD:238020 8/22 (36%)
FN3 1210..1308 CDD:238020 20/106 (19%)
fn3 1317..1402 CDD:278470 19/89 (21%)
FN3 1415..1507 CDD:238020 19/105 (18%)
FN3 1513..1608 CDD:238020 19/101 (19%)
fn3 1617..1708 CDD:278470 20/113 (18%)
FN3 1722..1823 CDD:238020 31/111 (28%)
FN3 1828..1920 CDD:238020 17/95 (18%)
FN3 1927..2016 CDD:238020 25/103 (24%)
OsmrNP_001005384.1 FN3 231..>276 CDD:304408 16/79 (20%)
fn3 333..414 CDD:278470 20/104 (19%)
WSXWS motif. {ECO:0000250} 413..417 0/4 (0%)
FN3 440..519 CDD:238020 31/98 (32%)
fn3 539..607 CDD:278470 16/85 (19%)
FN3 623..731 CDD:238020 25/109 (23%)
Box 1 motif. {ECO:0000250} 768..776 1/8 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.