DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sdk and IL31RA

Sequence 1:NP_001284756.1 Gene:sdk FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:NP_620586.3 Gene:IL31RA HGNCID:18969 Length:764 Species:Homo sapiens

Alignment Length:752 Identity:152/753 (20%)
Similarity:249/753 (33%) Gaps:269/753 (36%)


  Fly   732 LGPVPDPL---LNWITELSNVSADQRWILLENLKAATVYQFRVSAVNRVGEGSPSEPSNVVELPQ 793
            |.|.|..:   :.|...|        |:|      .::.:|.::|:       |::|.|      
Human    22 LSPQPSCVNLGMMWTWAL--------WML------PSLCKFSLAAL-------PAKPEN------ 59

  Fly   794 EAPSGPPVGFVGSARSMSEIITQWQPPLEEHRNGQILGY----ILRYRLFG--YNNVPWSYQNIT 852
                   :..|...|  ..:...|.|       |:...|    :.|...||  ::|...:.....
Human    60 -------ISCVYYYR--KNLTCTWSP-------GKETSYTQYTVKRTYAFGEKHDNCTTNSSTSE 108

  Fly   853 NEAQRNFLIQELITWKDYIVQIAAYNNMGVGVYTEGSKIKTK------EGVPEA-PPTNVKVEAI 910
            |.|..:|.:..:....:|.:::.|.|..||        ||:.      |.:.:. ||...:|:.:
Human   109 NRASCSFFLPRITIPDNYTIEVEAENGDGV--------IKSHMTYWRLENIAKTEPPKIFRVKPV 165

  Fly   911 --NSTAARCRWTPPNPQQINGINQGYKIQAWQRRLIDGEWRDI----ERRMKTVPPSLIDPLAEQ 969
              .....:..|..|   ::..::...|.....|.:....|.::    .|:.|           .|
Human   166 LGIKRMIQIEWIKP---ELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDK-----------NQ 216

  Fly   970 TAILGGLEKFTEYNISVLC-------FTDPGDGVASSQVAVMTMDDVPDEVTGLHFDDV------ 1021
            |..|.||:.||||.|::.|       ::|     .|.:...||.::.|   .||....|      
Human   217 TYNLTGLQPFTEYVIALRCAVKESKFWSD-----WSQEKMGMTEEEAP---CGLELWRVLKPAEA 273

  Fly  1022 -SDRSVKVLWAPPRASNGI--LTGYTVRYQVKDRPDTLKSFNLTADDTELTVNQLQATTHYWFEI 1083
             ..|.|::||...|.:..:  ..||.:.|..:...:..::.|.|....||.:    ....:|..:
Human   274 DGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQQLELHL----GGESFWVSM 334

  Fly  1084 VAWTRVGSGIPKTATIQSGVEPVLPHAPTALALSNIEAFS--------VVLQFTPGFDGNSSITK 1140
            :::..:|.....|..|.:..|.         :...||...        ||...:...|.|:    
Human   335 ISYNSLGKSPVATLRIPAIQEK---------SFQCIEVMQACVAEDQLVVKWQSSALDVNT---- 386

  Fly  1141 WKVEGQTARNMTWFTICEINDPDAETLTVTGLVPFTQYRLRLSASNVVGSSKPSEATKDFQTIQA 1205
            |.:|        ||.     |.|:|..|             ||..:|      |:||.  .||| 
Human   387 WMIE--------WFP-----DVDSEPTT-------------LSWESV------SQATN--WTIQ- 416

  Fly  1206 RPKHPPFNVTVRAMSAQQLRVRWIPLQQTEWYGNPRGYNIS-YKQLVKTPGTIKYVPRSVVIEDH 1269
            :.|..||               |.             |||| |..|....|           |.:
Human   417 QDKLKPF---------------WC-------------YNISVYPMLHDKVG-----------EPY 442

  Fly  1270 TANSHVLDSLEEWTLYEVKMNACNDVGCSKESDTAVERTREAVPSYGPLDVQANATSSTTVVVQW 1334
            :..::                                 .:|.|||.|| :.:.......||.:.|
Human   443 SIQAY---------------------------------AKEGVPSEGP-ETKVENIGVKTVTITW 473

  Fly  1335 GEVPRQHRNGQIDGYKVFYAAADRGQQVLHKTIPNNATFTTTLTELKKYVVYHVQVLAYTRLG-- 1397
            .|:|:..|.|.|..|.:||.|  .|.:...||: |::.....|..||:...|.|||:|.|..|  
Human   474 KEIPKSERKGIICNYTIFYQA--EGGKGFSKTV-NSSILQYGLESLKRKTSYIVQVMASTSAGGT 535

  Fly  1398 NGALSTPPIRVQTFEDTPGVPSNVSFPDVSLTMARII 1434
            ||                   ::::|..:|.::..||
Human   536 NG-------------------TSINFKTLSFSVFEII 553

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845
IG_like 280..356 CDD:214653
Ig 280..343 CDD:299845
IG_like 375..450 CDD:214653
Ig 378..447 CDD:143165
Ig 506..587 CDD:299845
IG_like 506..587 CDD:214653
I-set 592..682 CDD:254352
Ig 595..682 CDD:299845
FN3 686..789 CDD:238020 12/60 (20%)
FN3 798..893 CDD:238020 20/101 (20%)
FN3 901..1005 CDD:238020 24/117 (21%)
fn3 1011..1094 CDD:278470 17/92 (18%)
FN3 1108..1202 CDD:238020 20/102 (20%)
FN3 1210..1308 CDD:238020 11/99 (11%)
fn3 1317..1402 CDD:278470 29/87 (33%)
FN3 1415..1507 CDD:238020 4/21 (19%)
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
IL31RANP_620586.3 FN3 57..151 CDD:304408 23/124 (19%)
FN3 155..254 CDD:238020 24/118 (20%)
FN3 453..533 CDD:214495 29/84 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.