DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13367 and Gatad1

DIOPT Version :8

Sequence 1:NP_569851.2 Gene:CG13367 / 31013 FlyBaseID:FBgn0025634 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_001068512.2 Gene:Gatad1 / 500005 RGDID:1562004 Length:264 Species:Rattus norvegicus

Alignment Length:270 Identity:104/271 (38%)
Similarity:140/271 (52%) Gaps:40/271 (15%)


  Fly   162 LNGTANQAPTRSPTIIKRLRKSTRFKAKQTGKGTPGSGSSQSNGHNSGANGSTGSSVHLAGAGAH 226
            |..|.:...|.|.::.|:..:........||:|..|.|:..:.|  :|..|..|::. .|...|.
  Rat     5 LKPTCSMCKTTSSSMWKKSPQGEILCHHCTGRGGGGGGAGVAGG--TGGGGGFGTAT-FATTSAG 66

  Fly   227 PSNTNKHG---------------------KSGPAGTGG-ATGARNRRALFK-KPAQKTPKVQAST 268
            ||.:|..|                     ||.||.... :|..:.||.:|| |...|.|:..::.
  Rat    67 PSQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTI 131

  Fly   269 RFVRSLFHKGSYIQIGDIVSIVDSEQNL-YYAQIRGLLVDAYCEKSAFLTWLIPTQDSPDPQEGF 332
            ....|:|:||.|.||||:||::|.:... |||||||.:.|.||||||.|||||||..||..|  |
  Rat   132 VTAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLASPRDQ--F 194

  Fly   333 DPPTYLIGPDEELSRKLCYLEFVMHAPSNYYFDRSTPFP-LPDVDEYTAQRSGGYIWTRL----P 392
            ||.:|:|||:|:|.||:.|||||.||||.|:..||:||| :|...|      .|||||.:    .
  Rat   195 DPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPE------KGYIWTHVGPTPA 253

  Fly   393 IVKREKGSGH 402
            |..:|..:.|
  Rat   254 ITMKETVANH 263



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196397628
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4209
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007574
OrthoInspector 1 1.000 T1089206
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13340
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.