DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13367 and gatad1

DIOPT Version :8

Sequence 1:NP_569851.2 Gene:CG13367 / 31013 FlyBaseID:FBgn0025634 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_012819670.1 Gene:gatad1 / 100125784 XenbaseID:XB-GENE-965954 Length:276 Species:Xenopus tropicalis

Alignment Length:258 Identity:105/259 (41%)
Similarity:135/259 (52%) Gaps:37/259 (14%)


  Fly   162 LNGTANQAPTRSPTIIKRLRKSTRFKAKQTGKGTPGSGSSQSNGHNSGANGSTGSSVHLAG---A 223
            |..|.:...|.:.::.|:..:........:||.: .|.|...|.:|||..|||..|....|   |
 Frog    13 LKPTCSMCKTNTSSMWKKGNQGEILCNNCSGKSS-SSSSGGGNNNNSGGGGSTSGSSSYTGTNFA 76

  Fly   224 GAHPSNTNKHG---------------------KSGPA-GTGGATGARNRRALFK-KPAQKTPKVQ 265
            .|..|..:..|                     ||.|| ....:|..:.||.:|| |...|.|:..
 Frog    77 SASTSQQSNGGNTKQSKQEIHRRSARLRNTKYKSTPAVEKKVSTKGKGRRHIFKLKNPIKAPEAV 141

  Fly   266 ASTRFVRSLFHKGSYIQIGDIVSIVDSEQ-NLYYAQIRGLLVDAYCEKSAFLTWLIPTQDSPDPQ 329
            ::.....|:||||.|.||||:||:||.|. ..|||||||.:.|.||||||.|||||||..|  |:
 Frog   142 STIVTSESIFHKGLYYQIGDVVSVVDEEDGKTYYAQIRGFVQDQYCEKSAALTWLIPTMSS--PK 204

  Fly   330 EGFDPPTYLIGPDEELSRKLCYLEFVMHAPSNYYFDRSTPFP-LPDVDEYTAQRSGGYIWTRL 391
            :||||.||:|||||:|.||:..||||.||||.|:..||:||| :|...|      .|:|||.:
 Frog   205 DGFDPSTYIIGPDEDLPRKMECLEFVCHAPSEYFKSRSSPFPTIPTRPE------KGFIWTHI 261



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196397168
eggNOG 1 0.900 E1_2CNB2
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4102
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007574
OrthoInspector 1 1.000 T1061592
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6068
TreeFam 1 0.960
87.780

Return to query results.
Submit another query.