DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dredd and Strica

Sequence 1:NP_477249.3 Gene:Dredd FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster

Alignment Length:293 Identity:75/294 (26%)
Similarity:123/294 (42%) Gaps:55/294 (19%)


  Fly   219 PEP----DAAGTAAMAVKQEIESDNQQSYCSTQIDALK--LTRENAGIA--LIINQQKFHRNVSR 275
            |:|    .::|.....|....:|.:.|...||.:...|  ||:.....|  .|.|.::|      
  Fly   265 PKPFISLGSSGGTKPKVTAVAQSQDAQGTISTSLGISKSSLTKNKLKPARVYIFNHERF------ 323

  Fly   276 DNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLV-RDSLV 339
            ||..       ..|.|:..|.:.|...|..:...||...:...:.|.:.:|....:... :.:||
  Fly   324 DNKN-------EFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSALV 381

  Fly   340 VFILSHGFEEAVYASNSIAMKITDI---EDL---LCSYDTLYYKPKLLIIQACQEK------LVH 392
            :.|||||...     :.||.|..|.   :|:   :....||..||||:.:|||:..      :..
  Fly   382 LVILSHGTRH-----DQIAAKDDDYSLDDDVVFPILRNRTLKDKPKLIFVQACKGDCQLGGFMTD 441

  Fly   393 KKKPNELFRIDVTTVSPDQHIDMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADI 457
            ..:||.         ||:   ::|:..||..|:.:.| |:.|:.||.:||:|::|   |...:||
  Fly   442 AAQPNG---------SPN---EILKCYSTYEGFVSFR-TEDGTPFIQTLCEALNR---SGKTSDI 490

  Fly   458 LTIVTNEVSKKRGSNDESMVPNVKSTFRQHVYF 490
            .||:.|.....:..:.:..:|:|.||......|
  Fly   491 DTIMMNVRQVVKMQSKDRQIPSVTSTLTSKYVF 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 67/257 (26%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 63/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10454
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.