DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and Vps37d

DIOPT Version :8

Sequence 1:NP_001259101.1 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001121665.1 Gene:Vps37d / 687208 RGDID:1587769 Length:261 Species:Rattus norvegicus

Alignment Length:186 Identity:43/187 (23%)
Similarity:76/187 (41%) Gaps:23/187 (12%)


  Fly    25 AKEQEAGESDNLP-NLCTLSLDELKQLDRDPEFFEDFIEEMSVVQYLNEELDSMMDQVEIISREN 88
            |:...||.....| ....||..:|:.|.:|....:..:......|.|..|.|:.:.....:::||
  Rat     4 ARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLERDACLASNYALAKEN 68

  Fly    89 ECKGIHLVELKRRLSDDFTAL-----------KNLGEKCDRLNKKYFKKSDEYAPQHIRELLQIA 142
                   :.|:.||....|||           :|..:|..||.|...:    ::||.....||..
  Rat    69 -------LALRPRLEMGRTALAIKYQELREVAENCADKLQRLEKSMHR----WSPQCALGWLQAE 122

  Fly   143 ASNADGDCDRHVEHFLNGKTDVQTFLNTYQWSKKISTERKAKEERLGTQLSALERA 198
            ...|:.:.:..:|..|.|:..::.||..:|..:.::..|:.:.|:|...|...||:
  Rat   123 LEEAEQEAEVQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQEVLRRRERS 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_001259101.1 Mod_r 42..181 CDD:284587 33/150 (22%)
Vps37dNP_001121665.1 Mod_r 22..164 CDD:311259 34/153 (22%)
DUF4045 <198..>259 CDD:330572
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.