DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and VPS37C

DIOPT Version :10

Sequence 1:NP_525034.2 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_060436.4 Gene:VPS37C / 55048 HGNCID:26097 Length:355 Species:Homo sapiens


Alignment Length:148 Identity:41/148 - (27%)
Similarity:70/148 - (47%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SLDELKQLDRDPEFFEDFIEEMSVVQYLNEELD-SMMDQVEIISRENECKGIHLVELKR-RLSDD 105
            :|.||::|..|.|..:....|...||.|..|.: ::.....:..|..|.:|  .:|:.| .|||.
Human     8 TLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAERNLEFQG--PLEISRSNLSDR 70

  Fly   106 FTALKNLGEKCDRLNKKYFKKSDEYAPQHIRELLQIAASNADGDCDRHVEHFLNGKTDVQTFLNT 170
            :..|:.|.|:|.....|..|.|....|..:.:|||:.....:.:.:...|.||.|:..::|||..
Human    71 YQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAEKFLEGEVPLETFLEN 135

  Fly   171 YQWSKKISTERKAKEERL 188
            :...:.:|..|:.:.|:|
Human   136 FSSMRMLSHLRRVRVEKL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_525034.2 Mod_r 42..185 CDD:462117 39/143 (27%)
VPS37CNP_060436.4 Mod_r 5..149 CDD:462117 39/142 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..355
PRK12323 <187..>326 CDD:481241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.