DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and vps37a

DIOPT Version :8

Sequence 1:NP_001259101.1 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001015982.1 Gene:vps37a / 548736 XenbaseID:XB-GENE-969334 Length:382 Species:Xenopus tropicalis

Alignment Length:162 Identity:36/163 (22%)
Similarity:83/163 (51%) Gaps:4/163 (2%)


  Fly    34 DNLPNLCTLSLDELKQL-DRDPEFFEDFIEEMSVVQYLNEELDSMMDQVEIISRENECKGIHLVE 97
            :..|.|..||:.:|.:: |::....|.|:....:.|.::::.:.:.:..|:..|..:.:.:  :|
 Frog   214 ETFPELLELSVSQLSEMSDQEDVLLEQFVNLPQLKQVISDKEELVRNIEEMAKRNLQMEPV--LE 276

  Fly    98 LKRR-LSDDFTALKNLGEKCDRLNKKYFKKSDEYAPQHIRELLQIAASNADGDCDRHVEHFLNGK 161
            :||: :.|.:..|..|....::..::..:.|:..:...::..|::||..|:.:.|:..:.||.||
 Frog   277 VKRQAILDKYEQLMQLKLSFEKKLQRQHELSESCSLSALQARLKVAAHEAEEESDKIADEFLEGK 341

  Fly   162 TDVQTFLNTYQWSKKISTERKAKEERLGTQLS 193
            .::..||..:...:.....|:||||:|...:|
 Frog   342 IEIDEFLVNFMDKRTCCHSRRAKEEKLQQAIS 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_001259101.1 Mod_r 42..181 CDD:284587 27/141 (19%)
vps37aNP_001015982.1 Mod_r 221..361 CDD:284587 27/142 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C28799345
eggNOG 1 0.900 E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H45120
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007973
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.