DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and Vps37b

DIOPT Version :8

Sequence 1:NP_001259101.1 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_006249394.1 Gene:Vps37b / 288659 RGDID:1304576 Length:307 Species:Rattus norvegicus

Alignment Length:209 Identity:47/210 (22%)
Similarity:84/210 (40%) Gaps:47/210 (22%)


  Fly    22 SSEAKEQEAGESDNLPNLCTLSLDELKQLDRD----PEFFED------------------FIEEM 64
            |.|.:|||        :|.:||...:.||...    |..|..                  |::..
  Rat     5 SQEGEEQE--------SLLSLSAQRVGQLGDQGGAWPSAFPHAELAWEPTHQPGSHQPVCFLQTQ 61

  Fly    65 SVVQYLNEELDSMMDQVEIISRENECKGIHLVE-----LKRRLSDDFTALKNLGEKCDRLNKKYF 124
            :|..  |:|:       .:.|..:..:|..|.:     .|.||:..:..|:.|.|.......|..
  Rat    62 TVQH--NKEM-------TLASNRSLAEGNLLYQPQLDAQKARLTQKYQELQVLFEAYQIKKTKLD 117

  Fly   125 KKSDEYAPQHIRELLQIAASNADGDCDRHVEHFLNGKTDVQTFLNTYQWSKKISTERKAKEERLG 189
            |:|:..:.:.:..|||...:..:.|.:...|.||:|:..:..|::.||..:|::..|:.|.|:|.
  Rat   118 KQSNSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDAFIDVYQSKRKLAHIRRVKVEKLQ 182

  Fly   190 TQL---SALERAGI 200
            ..:   ..|.:||:
  Rat   183 ELVLKGQRLPQAGV 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_001259101.1 Mod_r 42..181 CDD:284587 34/166 (20%)
Vps37bXP_006249394.1 Mod_r 59..174 CDD:284587 27/124 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
21.860

Return to query results.
Submit another query.