DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Appl and aplp2

Sequence 1:NP_001245448.1 Gene:Appl FlyBaseID:FBgn0000108 Length:890 Species:Drosophila melanogaster
Sequence 2:XP_017951425.1 Gene:aplp2 XenbaseID:XB-GENE-5894468 Length:756 Species:Xenopus tropicalis

Alignment Length:901 Identity:226/902 (25%)
Similarity:356/902 (39%) Gaps:232/902 (26%)


  Fly    33 EPQIAVLCEAGQIYQPQYLSEEGRWVTDLSKKTTGPTCLRDKMDLLDYCKKAYPNRDITNIVESS 97
            |||:|:.|  |::.....: :.|:|..|.|..   .:|:..|.::|.||::.:|:..|||:||::
 Frog    38 EPQVAMFC--GKLNMHVNI-QTGKWEPDPSGT---KSCIGTKEEVLQYCQEVFPDLQITNVVEAN 96

  Fly    98 HYQKIGGWCRQGALNAAKCKGSHRWIKPFRCL-GPFQSDALLVPEGCLFDHIHNASRCWPFVRWN 161
            ....|..||::|   ..:|||....:.||:|| |.|.||.|||||.|.|.|......|.....|:
 Frog    97 QPVSIDNWCKKG---KKQCKGHSHIVVPFKCLVGEFVSDVLLVPEKCKFFHKERMDVCEGHQHWH 158

  Fly   162 QTGAAACQERGMQMRSFAMLLPCGISVFSGVEFVCCPKHFKTDEIHVKKTDLPVMPAAQINSAND 226
            .....||....|.:.|:.|||||.:..|.|.|:||||:....||...|:.:          ..:|
 Frog   159 NVAKEACMTEVMVLHSYGMLLPCAVDQFRGAEYVCCPQTKILDEALSKEEE----------EEDD 213

  Fly   227 ELVMNDEDDSNDSNYSKDANEDDLDDEDDLMGDDEEDDMVADEAATAGGSPNTGSSGDSNSGSLD 291
            |   .:::|..|...|:...|.|::|......::||::.|.||.                   ::
 Frog   214 E---EEDEDDYDLYKSEFPTEADVEDFTAAAEEEEEEEEVEDEV-------------------VE 256

  Fly   292 DINAEYDSGEEGDNYEEDGAGSESEAEVEASWDQSGGAKVVSLKSDSSSPSSAPVAPAPEKAPVK 356
            |.:..|      |||:::...:|:..|.......||...:..:||..|  ..|...|.....|..
 Frog   257 DRDYYY------DNYKDEDYNNENPTEPPNERQPSGKDIITDVKSVCS--QEAMTGPCRAMMPRW 313

  Fly   357 SESVTSTPQLSASAAAFVAANSGNSGTG--------------AGAPPSTAQPTSDPYFTHFDPHY 407
            ...:.     ......|:....|.:...              ....|:.|... |.||.......
 Frog   314 YFDLG-----QKKCVRFIYGGCGGNRNNFESEDYCMAVCKVMMAQTPAPADDV-DVYFETLADDN 372

  Fly   408 EHQSYKVSQKRLEESHREKVTRVMKDWSDLEEKYQDMRLADPKAAQSFKQRMTARFQTSVQALEE 472
            ||..::.::::||..|..::.||.|:|.:.|.:.|.:    |||.   :|.:...||.:|:|||:
 Frog   373 EHARFQKAKEQLEVRHHNRMERVKKEWEEAESQAQSL----PKAE---RQTLIQHFQATVKALEK 430

  Fly   473 EGNAEKHQLAAMHQQRVLAHINQRKREAMTCYTQALTEQPPNAHHVEKCLQKLLRALHKDRAHAL 537
            |..:||.||...|..||.|.:|.::|.|:..|..||....|..|.:.:.|::.:||.:|||.|.:
 Frog   431 EAASEKQQLVETHLARVEAMLNDKRRNALENYLSALQADSPRPHRILQALKRYVRAENKDRLHTI 495

  Fly   538 AHYRHLLNSGGPGGLEAAASERPRTLERLIDIDRAVNQSMTMLKRYPELSAKIAQLMNDYILALR 602
            .||.|:| :..|   |.||..:.:.:..|..|:..:|||:::|.:.|.                 
 Frog   496 RHYHHVL-AVDP---EKAAQMKSQVMTHLHVIEERMNQSLSLLYKVPY----------------- 539

  Fly   603 SKDDIPGSSLGMSEEAEAGILDKYRVEIERKVAEKERLRLAEKQRKEQRAAEREKLREEKLRLEA 667
                               :.|:.:.||:         .|.::||.:.                 
 Frog   540 -------------------VADEIQDEID---------ELFQEQRTDM----------------- 559

  Fly   668 KKVDDMLKSQVAEQQSQPTQSSTQSQAQQQQQEKSLP--GKELGPDAALVTAANPNLETTKSEKD 730
                |...|..:|.|.....||.:|       |:.||  ||...|   ......|::  |:||:.
 Frog   560 ----DQFTSSFSESQGDVRVSSEES-------EEILPKDGKPFRP---FQVKTFPSI--TESEET 608

  Fly   731 LSDTEY------GEATVST------KVQTVLPTVDDDAVQRAVEDVAAAVAHQEA------EPQV 777
            ..|:..      |.|.::|      |:.......|...|.....||...:.:.|.      ||  
 Frog   609 QRDSYLPVRKGSGMADLNTLIGAEEKIINSKSKADQKVVIDETLDVKEMIFNAERVSGLVDEP-- 671

  Fly   778 QHFMTHDLGHRESSFSLRREFAQHAHAAKEGRNVYFTLSFAGIALMAAVFVGVAVA--------- 833
                       ::...||.||                 ||:..||:..:.:.||:|         
 Frog   672 -----------DTDGPLRNEF-----------------SFSSGALIGLLVIAVAIATIIVISLVL 708

  Fly   834 --KWRTSRSPHAQGFIEVDQVGCQNVTTHHPIVREEKIVPNMQINGYENPTYKYFE 887
              |.:.....|  |.:|||.:          :..||:.:..||.:|||||||||.|
 Frog   709 LRKRQYGTISH--GIVEVDPM----------LTPEERHLNKMQNHGYENPTYKYLE 752

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApplNP_001245448.1 A4_EXTRA 26..198 CDD:128326 61/166 (37%)
APP_N 33..141 CDD:280358 40/109 (37%)
APP_Cu_bd 143..198 CDD:289676 20/55 (36%)
APP_E2 387..580 CDD:289677 63/193 (33%)
GBP_C <629..682 CDD:303769 8/53 (15%)
APP_amyloid 834..887 CDD:287486 19/53 (36%)
aplp2XP_017951425.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25283680
eggNOG 1 0.900 E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D405630at33208
OrthoFinder 1 1.000 FOG0000838
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.