DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Lyl1

DIOPT Version :10

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001007678.1 Gene:Lyl1 / 304663 RGDID:1359244 Length:278 Species:Rattus norvegicus


Alignment Length:138 Identity:44/138 - (31%)
Similarity:57/138 - (41%) Gaps:35/138 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PPKAGTISHPHKSQSDQSFG---------------TPGRKGLPL-----PQAVARR---NARERN 170
            ||......|||...:....|               .|....|.|     ||.||||   |:|||.
  Rat    96 PPTLALHYHPHPFLNSVYIGPAGPFSIFPNSRLKRRPSHGELDLVDGHQPQKVARRVFTNSRERW 160

  Fly   171 RVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFDFPPLN 235
            |.:.||..||.||:.:|....:            :||||.|.||:|::||..|.:||......|.
  Rat   161 RQQHVNGAFAELRKLLPTHPPD------------RKLSKNEVLRLAMKYIGFLVRLLRDQAAVLA 213

  Fly   236 SQGNSSGS 243
            |..::.||
  Rat   214 SGPSAPGS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 bHLH_TS_dAS-C_like 170..227 CDD:381587 19/56 (34%)
Lyl1NP_001007678.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
bHLH_TS_LYL1 145..209 CDD:381548 31/75 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..278 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.