DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Mesp1

DIOPT Version :10

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_032614.2 Gene:Mesp1 / 17292 MGIID:107785 Length:243 Species:Mus musculus


Alignment Length:136 Identity:38/136 - (27%)
Similarity:55/136 - (40%) Gaps:42/136 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SKTSVPAKKCKTNKKLAVERPPKAGTISHPHKSQSDQSFGTPGRKG-----LPLPQAVARRNARE 168
            ::.|.||..|        .||.:..              |||||:|     |...|   |::|.|
Mouse    44 AQASSPAPPC--------ARPARRA--------------GTPGRRGTHGSRLGSGQ---RQSASE 83

  Fly   169 RNRVKQVNNGFAL--LREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFDF 231
            |.:::......||  ||..:|..|:.          ..:.|:|:||||:|:.||..|..:||...
Mouse    84 REKLRMRTLARALHELRRFLPPSVAP----------TGQNLTKIETLRLAIRYIGHLSAVLGLSE 138

  Fly   232 PPLNSQ 237
            ..|..|
Mouse   139 DNLRRQ 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 bHLH_TS_dAS-C_like 170..227 CDD:381587 16/58 (28%)
Mesp1NP_032614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 18/66 (27%)
bHLH_SF 77..141 CDD:469605 23/76 (30%)
CPLCP 153..157
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.