DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and olig4

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001039180.1 Gene:olig4 / 734024 XenbaseID:XB-GENE-484736 Length:209 Species:Xenopus tropicalis


Alignment Length:218 Identity:45/218 - (20%)
Similarity:73/218 - (33%) Gaps:77/218 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MSSSVLSTNETFPTTINSATKIFRYQHIMPAPSPLIPGGNQNQPAGTMPIKTRKYTPRGMALTRC 77
            |.|..||:..:.|......:..|....:..|.|.    |.:..|.|.:....|:.|..       
 Frog     1 MDSDCLSSRSSSPEFDRGESPQFLSGAMFQAHSV----GQRMPPRGRVKAGKRELTQE------- 54

  Fly    78 SESVSSLSPGSSPAPYNVDQSQSVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGP 142
                              :|.:...:.|:|||.|:..:|.:...||:.:|.|          .||
 Frog    55 ------------------NQHELRLKVNSRERQRMHDLNQAMDGLREVMPYS----------HGP 91

  Fly   143 H-KKISKVDTLRIAVEYI-------RRLQDLVDDLNGGS---------------------NIGAN 178
            . :|:||:.||.:|..||       ..::.||:::.|..                     .:.|:
 Frog    92 SVRKLSKISTLILARNYIVMLSNSLEEMKRLVNEVYGAQRAPGCASSLSTRVPQLPPVMPTVPAS 156

  Fly   179 NAVTQLQLCLDESSSHSSSSSTC 201
            :..|.|.|         |||..|
 Frog   157 DYATYLSL---------SSSDIC 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 20/65 (31%)
olig4NP_001039180.1 bHLH_TS_OLIG2_like 59..121 CDD:381568 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.