DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and TCF21

DIOPT Version :10

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_003197.2 Gene:TCF21 / 6943 HGNCID:11632 Length:179 Species:Homo sapiens


Alignment Length:80 Identity:27/80 - (33%)
Similarity:43/80 - (53%) Gaps:13/80 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SPAPYNVDQSQSVQRR--NARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDT 151
            ||......:.:.|||.  |||||.|::.::.:|:||:..:|..           .|..|:||:||
Human    67 SPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWV-----------PPDTKLSKLDT 120

  Fly   152 LRIAVEYIRRLQDLV 166
            ||:|..||..|:.::
Human   121 LRLASSYIAHLRQIL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 bHLH_TS_dAS-C_like 100..166 CDD:381587 25/67 (37%)
TCF21NP_003197.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..87 6/19 (32%)
bHLH_TS_TCF21_capsulin 77..140 CDD:381547 25/70 (36%)

Return to query results.
Submit another query.