DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and MYC

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_002458.2 Gene:MYC / 4609 HGNCID:7553 Length:454 Species:Homo sapiens


Alignment Length:140 Identity:40/140 - (28%)
Similarity:55/140 - (39%) Gaps:34/140 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 HIMPAPSPLI-----PGGNQNQPAGTMPIKTRKYTPRG--------MALTRCSESVSSLSPGSSP 90
            |..|..|||:     ...:|:..|.  |..|||..|..        ..|.:.|.:....||.|| 
Human   302 HSKPPHSPLVLKRCHVSTHQHNYAA--PPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSS- 363

  Fly    91 APYNVDQSQSVQRR--NARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLR 153
                 |..::|:||  |..||.|..::..||..||..||:           ...::|..||..|:
Human   364 -----DTEENVKRRTHNVLERQRRNELKRSFFALRDQIPE-----------LENNEKAPKVVILK 412

  Fly   154 IAVEYIRRLQ 163
            .|..||..:|
Human   413 KATAYILSVQ 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 17/57 (30%)
MYCNP_002458.2 Myc_N 21..360 CDD:279405 14/59 (24%)
HLH 370..426 CDD:238036 20/64 (31%)
Myc-LZ 423..453 CDD:280500 40/140 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.