DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and Oli

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster


Alignment Length:225 Identity:55/225 - (24%)
Similarity:87/225 - (38%) Gaps:63/225 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTTINSATKIFRYQHIMPAPSP--LIPG-------------------------GNQNQPAGTMPI 62
            |.|.|    :...||..|..||  .:||                         .::|:|..:.|.
  Fly    22 PPTAN----MLGGQHPAPTASPPQSVPGRRTPLGSVGLGGFYAQGMGMSQQPPTDENKPGPSAPE 82

  Fly    63 KTRKYTPRGMALTRCS---ESVSSLSPGSSPAPYNVDQSQSVQRR------NARERNRVKQVNNS 118
            |....|...:|....|   .:|:..|.|:|.:..|..:.::.|.:      |||||.|:..:|::
  Fly    83 KPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSGKQKNRQGKTVRLNINARERRRMHDLNDA 147

  Fly   119 FARLRQHIPQSIITDLTKGGGRGPH-KKISKVDTLRIAVEYI----------RRLQDLVDDLNGG 172
            ...||..||.:          ..|. :|:||:.||.:|..||          |||...:....|.
  Fly   148 LDELRSVIPYA----------HSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYIQSTTGA 202

  Fly   173 S--NIGANNAVTQLQLCLDESSSHSSSSST 200
            :  ::||..|..:||..|....:...:||:
  Fly   203 APLDLGAFPAAAKLQALLQGPHNEPPTSSS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 22/68 (32%)
OliNP_001188830.1 HLH 134..188 CDD:197674 20/63 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.