DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and atoh7

DIOPT Version :10

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_012822645.1 Gene:atoh7 / 100493495 XenbaseID:XB-GENE-989022 Length:115 Species:Xenopus tropicalis


Alignment Length:72 Identity:26/72 - (36%)
Similarity:41/72 - (56%) Gaps:14/72 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SVQRR---NARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRR 161
            |.:||   |||||.|::.:|.:|..||:.:||           .|..||:||.:||::|:.||..
 Frog     8 STKRRMAANARERRRMQGLNTAFDSLRKVVPQ-----------WGEDKKLSKYETLQMALSYIMA 61

  Fly   162 LQDLVDD 168
            |..::.:
 Frog    62 LNRILSE 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 bHLH_TS_dAS-C_like 100..166 CDD:381587 26/68 (38%)
atoh7XP_012822645.1 bHLH_TS_ATOH7 4..72 CDD:381557 26/72 (36%)

Return to query results.
Submit another query.